YMRLLLMFDMPTDTASDRKAYRKFRKFLINEGFIMHQFSVYSKILLNDTANKAMLARLKQNNPQRGLITLLNVTEKQFSR
MIYLHGEQDNRVANSDERIVFLGE
The query sequence (length=104) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5xvn:F | 108 | 104 | 1.0000 | 0.9630 | 1.0000 | 1.53e-74 | 5xvn:E, 5xvn:M, 5xvn:N, 5xvo:E, 5xvo:F, 5xvo:M, 5xvo:N, 5xvp:E, 5xvp:F |
2 | 8q2n:D | 108 | 104 | 0.7308 | 0.7037 | 0.7308 | 1.69e-56 | 8pk1:A, 8pk1:D, 8q2n:A |
3 | 8ia4:B | 92 | 86 | 0.3750 | 0.4239 | 0.4535 | 7.49e-24 | |
4 | 5xy3:J | 164 | 39 | 0.1250 | 0.0793 | 0.3333 | 4.6 | |
5 | 8oxm:A | 2748 | 36 | 0.1346 | 0.0051 | 0.3889 | 5.2 | 8oxm:B |
6 | 7sic:A | 2773 | 36 | 0.1346 | 0.0050 | 0.3889 | 5.2 | 8oxo:A, 8oxo:B, 8oxp:A, 8oxp:B, 7sic:B, 7sid:A, 7sid:C |
7 | 7ni5:A | 2791 | 36 | 0.1346 | 0.0050 | 0.3889 | 5.3 | 7ni4:A, 7ni4:B, 7ni5:B, 7ni6:A, 7ni6:B, 8oxq:A, 8oxq:B |
8 | 6h61:A | 660 | 30 | 0.1346 | 0.0212 | 0.4667 | 5.6 | 6g1s:A, 6g1x:A, 7nga:A |
9 | 5zi5:A | 850 | 65 | 0.1827 | 0.0224 | 0.2923 | 7.8 | 5zi5:B, 5zi7:A, 5zi7:B, 5zie:A, 5zie:B |