YKLYIMTFQNAHFGSGTLDSSKLTFSADRIFSALVLESLKMGKLDAFLAEANQDKFTLTDAFPFQFGPFLPKPIGYPKHD
QIDQSVDVKEVRRQAKLSKKLQFLALENVDDYLNGELFENEEHAVIDTVTKNQPHKDGNLYQVATTRFSNDTSLYVIANE
SDLLNELMSSLQYSGLGGKRSSGFGRFELDIQNIPLELSDRLTKNHSDKVMSLTTALPVDADLEEAMEDGHYLLTKSSGF
AFSHATNENYRKQDLYKFASGSTFSKTFEGQIVDVRPLDFPHAVLNYAKPLFFKL
The query sequence (length=295) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ifn:B | 297 | 295 | 0.9932 | 0.9865 | 0.9932 | 0.0 | 6ifk:B, 6ifr:B, 6ify:B, 6ifz:B, 6ig0:B, 6nud:I, 6nue:I |
2 | 6ifl:G | 273 | 295 | 0.9153 | 0.9890 | 0.9153 | 0.0 | 6ifu:G |
3 | 9ash:B | 297 | 299 | 0.4034 | 0.4007 | 0.3980 | 3.47e-45 | 9asi:B, 6xn5:B |
4 | 6xn7:B | 277 | 293 | 0.3831 | 0.4079 | 0.3857 | 1.18e-41 | 6xn3:B, 6xn4:B |
5 | 8wfx:M | 296 | 314 | 0.3729 | 0.3716 | 0.3503 | 2.44e-41 | |
6 | 7v01:H | 297 | 316 | 0.3525 | 0.3502 | 0.3291 | 9.92e-41 | 8do6:B, 7uzw:H, 7uzx:H, 7uzy:H, 7uzz:H, 7v00:H, 7v02:H |
7 | 6mur:E | 286 | 231 | 0.1864 | 0.1923 | 0.2381 | 6.26e-06 | 6iqw:E, 6mus:E, 6mut:E, 6muu:E, 6o7e:E, 6o7h:E, 6o7i:E |
8 | 7xqp:9 | 225 | 100 | 0.0949 | 0.1244 | 0.2800 | 0.50 | 8htu:9 |
9 | 2j68:A | 680 | 57 | 0.0712 | 0.0309 | 0.3684 | 1.9 | 2w6d:A, 2w6d:B |
10 | 5om9:A | 396 | 20 | 0.0339 | 0.0253 | 0.5000 | 4.5 | 3fju:A, 6i6z:A, 6i6z:B, 5om9:B, 4uee:A, 4uee:B, 4uez:A, 4uez:B, 2v77:A, 2v77:B |
11 | 3bdv:A | 191 | 62 | 0.0712 | 0.1099 | 0.3387 | 5.3 | |
12 | 3kl8:G | 259 | 92 | 0.0746 | 0.0849 | 0.2391 | 7.6 | 3kl8:A, 3kl8:C |