YIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWVGVGIVLISLLSWGFFGQRL
DLPAIIGMMLICAGVLIINLLS
The query sequence (length=102) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8uoz:A | 110 | 102 | 0.9902 | 0.9182 | 0.9902 | 8.87e-67 | 7jk8:A, 7jk8:B, 7mgx:A, 7mgx:B, 7mgx:E, 7mgx:F, 7sfq:A, 7sfq:B, 7ssu:A, 7ssu:B, 7sv9:B, 7sv9:A, 7svx:B, 8uoz:B |
2 | 7szt:A | 104 | 86 | 0.3333 | 0.3269 | 0.3953 | 2.53e-12 | 8tgy:A, 8tgy:E, 8vxu:A, 8vxu:B, 8vxu:C, 8vxu:D, 6wk8:B, 6wk8:A, 6wk9:B, 6wk9:A, 6wk9:F, 6wk9:E |
3 | 6fhw:B | 587 | 24 | 0.0686 | 0.0119 | 0.2917 | 6.1 | 6fhw:A |
4 | 5sy1:A | 582 | 89 | 0.2647 | 0.0464 | 0.3034 | 6.5 | 5sy1:B |