BioLiP

>protein
YILDKIGLNIEILESLSYESKLGMSFKRTLSHFNKEEVLKEIELINNWYFSLEIIDDLPLDSRIKSVSSAKMKFERYYPN
ATYNRVFNDILGFRVICKSYDEVLELEKEDKIRVVDMSGFRGIHVYYQRDNHHYPIEIQFNTYYDRQLNDWLHDKFY

The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8pu1:B	191	163	0.9936	0.8168	0.9571	1.21e-110	8pu4:A, 8pu4:B, 8pu4:C
2	3fp5:A	106	36	0.0764	0.1132	0.3333	2.6
3	7zu8:A	336	72	0.1210	0.0565	0.2639	2.8	7zva:A, 7zvb:A, 7zvc:A
4	4iub:L	602	37	0.0701	0.0183	0.2973	2.9	5d51:L, 4iuc:L, 4iud:L, 5mdj:L, 5mdk:L, 5mdl:L, 7odg:L, 7odh:L, 8pou:L, 8pov:L, 8pow:L, 8pox:L, 8poz:L, 3rgw:L, 4ttt:L
5	1w15:A	132	39	0.0828	0.0985	0.3333	3.9
6	3iqe:A	282	33	0.0828	0.0461	0.3939	4.1	3iqe:D, 3iqe:B, 3iqe:F, 3iqe:C, 3iqe:E, 3iqf:A, 3iqf:D, 3iqf:B, 3iqf:F, 3iqf:C, 3iqf:E, 3iqf:G, 3iqf:J, 3iqf:H, 3iqf:L, 3iqf:I, 3iqf:K, 3iqz:A, 3iqz:D, 3iqz:B, 3iqz:F, 3iqz:C, 3iqz:E
7	5lui:A	264	27	0.0637	0.0379	0.3704	4.3	5luk:A, 5lul:A, 7xtt:B, 7xtv:A, 7xtv:B
8	1iwa:A	473	19	0.0701	0.0233	0.5789	6.0	1bwv:A, 1bwv:C, 1bwv:E, 1bwv:G, 4f0h:A, 1iwa:C, 1iwa:E, 1iwa:I, 1iwa:K, 1iwa:M, 1iwa:O
9	6ewz:A	202	105	0.1592	0.1238	0.2381	8.1	6ewz:B, 6ex0:A, 6ex0:B, 6fgx:A, 6fgx:B
10	4pzk:A	159	45	0.0828	0.0818	0.2889	8.8	4pzk:B

[Back]