BioLiP

>protein
YIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLK
VHGF

The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7a09:Z	110	84	1.0000	0.7636	1.0000	1.09e-57	9bln:W, 4kzx:l, 4kzy:l, 8pj1:p, 8ppk:p, 8ppl:Ip, 7qp6:p, 8xxn:C1, 6ybw:p, 6zmw:p, 6zp4:Z, 6zvj:N
2	6gsm:m	96	85	0.6190	0.5417	0.6118	1.31e-35	8cah:m, 6gsn:m, 3j80:j, 3j81:m, 3jam:j, 3jap:m, 4uer:F, 6zce:m
3	8s8f:m	77	85	0.5119	0.5584	0.5059	1.08e-25	8s8i:m
4	4bts:AF	89	83	0.4762	0.4494	0.4819	2.53e-24	4bts:BF, 4bts:CF, 4bts:DF, 4v5o:AF, 4v5o:BF
5	7ase:V	97	83	0.3929	0.3402	0.3976	4.84e-21
6	5jb3:1	83	76	0.3214	0.3253	0.3553	9.40e-07	5jbh:1
7	5zcy:A	83	76	0.2857	0.2892	0.3158	2.25e-05
8	8xr6:Q	143	70	0.1905	0.1119	0.2286	2.0	8xr6:q
9	4hjw:C	378	40	0.1429	0.0317	0.3000	2.2	4hjw:A, 4hjw:B
10	2vs1:A	398	43	0.1429	0.0302	0.2791	3.6	2jjq:A
11	3pgx:A	270	59	0.2024	0.0630	0.2881	4.0	3pgx:B, 3pgx:C, 3pgx:D
12	8pdv:A	1027	29	0.1548	0.0127	0.4483	4.6	8pd8:A, 8pd8:B, 8pd9:A, 8pdu:A, 8pdu:B
13	8xq7:A	1041	29	0.1548	0.0125	0.4483	4.6	8xq7:B
14	8otq:A	1051	29	0.1548	0.0124	0.4483	4.6	8otq:B, 8otw:B, 8xq8:A
15	1zt2:A	327	67	0.2262	0.0581	0.2836	5.7	5of3:A, 5of3:D, 5ofn:A, 1zt2:C
16	8jxu:A	1410	28	0.1190	0.0071	0.3571	6.8	8jxq:A
17	4zyj:D	392	16	0.1190	0.0255	0.6250	6.9	4zyj:A, 4zyj:B, 4zyj:C
18	1gkr:A	451	46	0.1548	0.0288	0.2826	8.7	1gkr:B, 1gkr:C, 1gkr:D
19	5hyc:A	130	47	0.1310	0.0846	0.2340	9.9

[Back]