YGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQ
IAQLIAGYIDIIL
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6mfs:A | 370 | 93 | 1.0000 | 0.2514 | 1.0000 | 9.92e-63 | 2g35:A, 2k00:A, 1mk7:B, 1mk7:D, 1mk9:B, 1mk9:D, 1mk9:F, 1mk9:H, 2mwn:B, 1y19:B, 1y19:D, 1y19:F, 1y19:H, 1y19:J, 1y19:L |
2 | 8tec:A | 448 | 91 | 0.2473 | 0.0513 | 0.2527 | 3.86e-04 | 8tee:A, 8tee:B |
3 | 3n91:A | 315 | 58 | 0.1828 | 0.0540 | 0.2931 | 2.8 | |
4 | 7txl:A | 275 | 45 | 0.1613 | 0.0545 | 0.3333 | 3.5 | 7txk:A, 7txk:B, 7txl:B |
5 | 2c2c:A | 112 | 57 | 0.1505 | 0.1250 | 0.2456 | 3.9 | 3c2c:A |
6 | 5jb3:S | 67 | 46 | 0.1505 | 0.2090 | 0.3043 | 5.0 | 5jbh:S, 6sw9:S, 6swc:S, 6swe:S, 4v4n:BS, 4v6u:AS, 7zag:S, 7zah:S, 7zai:S, 7zhg:S |
7 | 3tto:A | 1055 | 31 | 0.1290 | 0.0114 | 0.3871 | 6.0 | 3tto:B, 3tto:C, 3tto:D, 3ttq:A, 4ttu:A, 4tvc:A, 4tvd:A |
8 | 8h3m:C | 930 | 21 | 0.1183 | 0.0118 | 0.5238 | 9.1 | |
9 | 7xu5:B | 938 | 21 | 0.1183 | 0.0117 | 0.5238 | 9.1 | 7xu5:A, 7xu5:C |
10 | 7q9f:A | 1009 | 21 | 0.1183 | 0.0109 | 0.5238 | 9.1 | 7akd:C, 7l56:B, 7l56:C, 7l56:A, 7q9f:B |
11 | 7od3:A | 1012 | 21 | 0.1183 | 0.0109 | 0.5238 | 9.1 | 7od3:B, 7od3:C |
12 | 7tei:B | 1042 | 21 | 0.1183 | 0.0106 | 0.5238 | 9.1 | |
13 | 7wuh:E | 1044 | 21 | 0.1183 | 0.0105 | 0.5238 | 9.1 | 7wuh:A, 7xu3:B, 7xu3:A, 7xu3:C, 6zb5:A, 6zb5:C, 6zb5:B |
14 | 8xus:B | 1063 | 21 | 0.1183 | 0.0103 | 0.5238 | 9.1 | 8if2:B |
15 | 8bon:B | 1070 | 21 | 0.1183 | 0.0103 | 0.5238 | 9.1 | 8bon:A, 8bon:C, 7nd7:A, 7nd7:B, 7nd7:C, 8xut:B, 8xut:A |
16 | 8hlc:A | 1081 | 21 | 0.1183 | 0.0102 | 0.5238 | 9.2 | 7e7d:A, 7e7d:B, 7e7d:C, 8h3e:A, 8h3e:B, 8h3e:C, 8hlc:B, 8hlc:C, 7odl:A, 7odl:B, 7odl:C, 7wgx:A, 7wgx:B, 7wgx:C, 6zb4:C, 6zb4:B, 6zb4:A, 6zoz:A, 6zoz:B, 6zoz:C |
17 | 8cya:A | 1100 | 21 | 0.1183 | 0.0100 | 0.5238 | 9.2 | 7nt9:A, 7nt9:B, 7nt9:C, 7nta:B, 7nta:C, 7nta:A, 7ntc:A, 7ntc:B, 8p9y:C |
18 | 7jji:A | 1109 | 21 | 0.1183 | 0.0099 | 0.5238 | 9.2 | 8aaa:A, 7b62:A, 7beh:E, 7bem:E, 8bec:B, 8bec:D, 7d2z:B, 7d30:B, 7dwy:A, 7dwy:B, 7dwy:C, 7e7b:A, 7e7b:B, 7e7b:C, 7f5g:C, 8j1q:C, 8j26:C, 7jji:C, 7jji:B, 7kmh:C, 7l2c:B, 7l4z:B, 7l4z:D, 7l4z:A, 7l4z:C, 7l4z:E, 7ldj:A, 7ly3:A, 7ly3:B, 7q0i:D, 8qh0:A, 7qur:A, 7qur:B, 7qur:C, 7qus:A, 7qus:B, 7qus:C, 7r6w:R, 7sn0:C, 7wd8:B, 7wgv:A, 7wgv:B, 7wgv:C, 7wk8:A, 7x08:A, 7x08:B, 7x08:C, 7x2l:E, 7x93:G, 7xtz:A, 7xtz:C, 7xtz:B, 7xu0:C, 7xu0:B, 7xu1:A, 7xu6:A, 7xu6:C, 7xu6:B, 7xwa:D, 7y0c:E, 7y0c:R, 7yck:A, 7z8o:A, 7zbu:A, 6zp2:A, 6zp2:C, 6zp2:B |
19 | 7zaz:CCC | 690 | 15 | 0.0753 | 0.0101 | 0.4667 | 9.5 |