BioLiP

>protein
YFQMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYA
QVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVR
RKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP

The query sequence (length=214) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2y8w:A	215	211	0.9860	0.9814	1.0000	1.45e-147	3qrp:A, 3qrq:A, 3qrr:A, 2y8y:A, 2y9h:A, 2y9h:C, 2y9h:E, 2y9h:G, 2y9h:I
2	2y9h:M	193	211	0.8925	0.9896	0.9052	2.06e-125	2y9h:K, 2y9h:O
3	8yha:B	268	266	0.3832	0.3060	0.3083	3.16e-17	8yb6:B
4	5cd4:A	199	222	0.3178	0.3417	0.3063	5.59e-17	5cd4:M, 4tvx:A, 4tvx:M, 4u7u:D, 4u7u:P
5	6c66:O	212	220	0.3084	0.3113	0.3000	2.87e-14	5u0a:A
6	5h9f:K	159	211	0.2991	0.4025	0.3033	7.26e-14	5h9e:K
7	4qyz:K	152	210	0.2710	0.3816	0.2762	1.11e-09
8	5u07:A	190	217	0.2944	0.3316	0.2903	7.10e-07
9	2okk:A	483	76	0.1075	0.0476	0.3026	0.072
10	8gz0:B	160	36	0.0701	0.0938	0.4167	1.3	8gz0:A, 7wrk:A, 7wwn:A, 7wwo:A, 7wwo:B
11	6jdv:A	1036	40	0.0514	0.0106	0.2750	4.2	6kc8:A
12	6jdq:A	1069	40	0.0514	0.0103	0.2750	4.2	6je4:A, 6je4:E, 6je4:K, 6je9:A
13	6kc7:A	963	40	0.0514	0.0114	0.2750	4.3
14	6je4:O	1049	40	0.0514	0.0105	0.2750	4.5	8hj4:A, 8ja0:A, 6je9:C
15	6fdz:U	265	61	0.0794	0.0642	0.2787	7.7	6fdy:U
16	6jx3:B	85	59	0.0888	0.2235	0.3220	7.9

[Back]