YEWGVRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKDPRFYRSPPLHEHPLYKDQACYIFHHR
The query sequence (length=387) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8any:5 |
394 |
392 |
1.0000 |
0.9822 |
0.9872 |
0.0 |
7a5f:53, 7a5g:53, 7a5h:5, 7a5i:53, 7a5j:5, 7a5k:53, 6i9r:5, 3j7y:5, 3j9m:5, 8k2a:Lk, 8k2b:Lk, 7l08:5, 7l20:5, 6nu2:5, 6nu3:5, 7o9k:5, 7o9m:5, 7odr:5, 7ods:5, 7odt:5, 7of0:5, 7of2:5, 7of3:5, 7of4:5, 7of5:5, 7of6:5, 7of7:5, 7og4:5, 7oi6:5, 7oi7:5, 7oi8:5, 7oi9:5, 7oia:5, 7oib:5, 7oic:5, 7oid:5, 7oie:5, 8oir:Bm, 8oit:Bm, 5ool:5, 5oom:5, 7pd3:5, 8pk0:5, 7po4:5, 7qh6:5, 7qh7:5, 7qi4:5, 7qi5:5, 7qi6:5, 8qsj:5, 8qu1:5, 8qu5:5, 6vlz:5, 6vmi:5, 8xt0:Lk, 8xt1:Lk, 8xt2:Lk, 8xt3:Lk, 6zm5:5, 6zm6:5, 6zs9:5, 6zsa:5, 6zsb:5, 6zsc:5, 6zsd:5, 6zse:5, 6zsg:5 |
2 |
5aj4:Ba |
393 |
392 |
0.8527 |
0.8397 |
0.8418 |
0.0 |
6gaw:Ba, 6gb2:Ba, 7nqh:Ba, 7nql:Ba, 7nsh:Ba, 7nsi:Ba, 7nsj:Ba, 8oin:Bm, 8oiq:Bm, 6ydp:Ba, 6ydw:Ba |
3 |
7a5f:s3 |
370 |
120 |
0.1034 |
0.1081 |
0.3333 |
2.40e-05 |
7a5g:s3, 7a5h:s, 7a5i:s3, 7a5j:s, 7a5k:s3, 6i9r:s, 3j7y:s, 3j9m:s, 8k2a:Sf, 8k2b:Sf, 6nu2:s, 6nu3:s, 7o9k:s, 7of0:s, 7of2:s, 7of3:s, 7of4:s, 7of5:s, 7of6:s, 7of7:s, 7og4:s, 7oi6:s, 7oi7:s, 7oi8:s, 7oi9:s, 7oia:s, 7oib:s, 7oic:s, 7oid:s, 7oie:s, 5ool:s, 5oom:s, 7pd3:s, 7qh6:s, 7qh7:s, 8qu5:s, 8xt0:Sf, 8xt1:Sf, 8xt2:Sf, 8xt3:Sf, 6zs9:s, 6zsa:s, 6zsb:s, 6zsc:s, 6zsd:s, 6zse:s, 6zsg:s |
4 |
7l08:s |
393 |
120 |
0.1034 |
0.1018 |
0.3333 |
2.91e-05 |
8any:s, 7l20:s, 7o9m:s, 7odr:s, 7ods:s, 7odt:s, 8oir:Bi, 8oit:Bi, 8pk0:s, 7po4:s, 7qi4:s, 7qi5:s, 7qi6:s, 8qsj:s, 6vlz:s, 6vmi:s, 6zm5:s, 6zm6:s |
5 |
5aj4:Bw |
387 |
119 |
0.0982 |
0.0982 |
0.3193 |
2.57e-04 |
6gaw:Bw, 6gb2:Bw, 7nqh:Bw, 7nql:Bw, 7nsh:Bw, 7nsi:Bw, 7nsj:Bw, 8oin:Bi, 8oiq:Bi, 6ydp:Bw, 6ydw:Bw |
6 |
1h0n:A |
288 |
114 |
0.0724 |
0.0972 |
0.2456 |
0.055 |
1h0o:A, 2uw2:A, 3vpm:A, 3vpm:B, 3vpn:A, 3vpn:B, 3vpo:A, 3vpo:B, 1w68:A, 1w69:A, 1xsm:A |
7 |
4bet:A |
480 |
126 |
0.0698 |
0.0563 |
0.2143 |
1.3 |
4bep:A, 4ber:A, 4ber:B, 4bes:A, 4bet:B |
8 |
6yuf:D |
1272 |
45 |
0.0362 |
0.0110 |
0.3111 |
2.7 |
|
9 |
4hhd:A |
152 |
83 |
0.0543 |
0.1382 |
0.2530 |
4.0 |
4hhd:B |