YDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGI
GYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFH
ALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLF
LHFWYRAYTKGQRLPK
The query sequence (length=256) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6y7f:B | 256 | 256 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 6y7f:A |
2 | 8fkv:NI | 647 | 36 | 0.0430 | 0.0170 | 0.3056 | 1.8 | 8fkt:NI, 8fku:NI, 8fkw:NI, 8fkx:NI, 8fky:NI |
3 | 8goa:A | 367 | 115 | 0.1133 | 0.0790 | 0.2522 | 2.0 | 8goa:B, 8goa:C, 8goa:D, 8gob:A, 8gob:B, 8x6m:A, 8x6m:B, 5zxl:A, 5zxl:B, 5zxl:C, 5zxl:D |
4 | 5u8t:2 | 583 | 41 | 0.0625 | 0.0274 | 0.3902 | 3.5 | |
5 | 7zgm:A | 702 | 52 | 0.0703 | 0.0256 | 0.3462 | 4.0 | |
6 | 6kmx:aA | 717 | 119 | 0.1133 | 0.0404 | 0.2437 | 5.7 | 6kmx:bA, 6kmx:cA |
7 | 8k1g:A | 367 | 61 | 0.0664 | 0.0463 | 0.2787 | 7.2 | 8k1h:A |
8 | 3bxu:A | 71 | 26 | 0.0508 | 0.1831 | 0.5000 | 10.0 | 3bxu:B |