BioLiP

>protein
YANQYDPSLLQPVPRSLNRNDLHLSATLPFQGCDIWTLYELSWLNQKGLPQVAIGEVSIPATSANLIESKSFKLYLNSYN
QTRFASWDEVQTRLVHDLSACAGETVTVNVKSLNEYTAEPIVTMQGECIDDQDIEIANYEFDDALLQGAAQGEEVSEVLH
SHLLKSNPDWGSVEIAYHGAKMNREALLRYLVSFREHNEFHEQCVERIFTDIMRYCQPQSLTVYARYTRRGGLDINPFRS
SHQSAPNHNQRMARQ

The query sequence (length=255) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3s19:A	261	261	0.9961	0.9732	0.9732	0.0	3bp1:A, 3bp1:B, 3bp1:C, 3bp1:D, 4ghm:A, 4ghm:B, 4iqi:A, 4iqi:B, 3rzp:A, 3rzp:B, 3rzp:C, 3rzp:D, 3s19:B, 3s19:C, 3s19:D, 3uxj:A, 3uxj:B, 3uxj:C, 3uxj:D, 3uxv:A, 3uxv:B, 3uxv:C, 3uxv:D
2	4f8b:B	145	88	0.1137	0.2000	0.3295	3.87e-11	4f8b:A, 4f8b:C, 4f8b:D, 4f8b:E, 4fgc:A, 4fgc:B, 4fgc:C, 4fgc:D, 4fgc:E, 5udg:A, 5udg:D, 5udg:E
3	4uph:A	504	92	0.1098	0.0556	0.3043	0.049	4uph:B, 4uph:C, 4uph:D
4	2ckp:A	316	161	0.1373	0.1108	0.2174	0.32
5	3va7:A	1130	58	0.0667	0.0150	0.2931	0.32
6	7bkb:E	411	72	0.0941	0.0584	0.3333	3.5	7bkb:e, 7bkc:E, 7bkc:e, 7bkd:E, 7bke:E
7	5tuk:B	373	34	0.0471	0.0322	0.3529	3.9	5tuk:A, 5tuk:C, 5tuk:D
8	6vbz:A	256	26	0.0431	0.0430	0.4231	5.4	6vbz:B
9	6cnb:B	1114	80	0.0863	0.0197	0.2750	7.3	8bws:B, 6cnc:B, 6cnd:B, 6cnf:B, 6eu0:B, 6eu1:B, 6f40:B, 6f41:B, 6f42:B, 6f44:B, 5fj8:B, 5fja:B, 6tut:B, 7z0h:B, 7z1l:B, 7z1m:B, 7z1n:B, 7z1o:B, 7z2z:B, 7z30:B, 7z31:B
10	3nqb:A	587	39	0.0471	0.0204	0.3077	9.5	3nqb:B, 3t81:A, 3t81:B

[Back]