WTPTTEQIKILKELYYNNAIRSPTADQIQKITARLRQFGKIEGKNVFYWFQNHKARERQKK
The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6ryd:A | 69 | 61 | 1.0000 | 0.8841 | 1.0000 | 7.01e-41 | 6ryd:B, 6ryd:E, 6ryd:F, 6ryi:A, 6ryi:B, 6ryi:C, 6ryi:D, 6ryi:E, 6ryl:A, 6ryl:B, 6ryl:C, 6ryl:D, 6ryl:E |
| 2 | 6wig:A | 84 | 61 | 0.7049 | 0.5119 | 0.7049 | 1.41e-27 | 6wig:B |
| 3 | 3q9t:A | 577 | 41 | 0.1967 | 0.0208 | 0.2927 | 1.1 | 3q9t:B, 3q9t:C, 5zu2:A, 5zu2:B, 5zu2:C, 5zu3:A, 5zu3:B, 5zu3:C |
| 4 | 8isk:B | 848 | 19 | 0.1311 | 0.0094 | 0.4211 | 1.2 | 8isk:A |
| 5 | 6ayo:A | 229 | 39 | 0.1967 | 0.0524 | 0.3077 | 1.7 | 6ayo:B, 6ayq:A, 6ayq:B, 6ayr:A, 6ayr:B, 6ayr:C, 6ayr:D, 6ays:A, 6ays:B, 6ays:C, 6ays:G, 6ays:D, 6ays:H, 6ays:E, 6ays:F, 6ayt:A, 6ayt:B, 6ayt:C, 6ayt:D |
| 6 | 5hod:A | 61 | 60 | 0.2951 | 0.2951 | 0.3000 | 4.0 | 5hod:D |
| 7 | 3kpt:B | 355 | 32 | 0.1967 | 0.0338 | 0.3750 | 4.6 | |
| 8 | 1xkq:A | 272 | 44 | 0.2951 | 0.0662 | 0.4091 | 6.5 | 1xkq:B, 1xkq:C, 1xkq:D |
| 9 | 2oo0:A | 419 | 22 | 0.1475 | 0.0215 | 0.4091 | 7.0 | 5bwa:A, 7odc:A, 2on3:A, 2on3:B, 2oo0:B, 7s3f:A, 7s3f:B, 7s3g:A, 7s3g:B, 7u6p:A, 7u6p:B, 7u6u:A, 7u6u:B, 4zgy:A |
| 10 | 8iff:A | 868 | 18 | 0.1148 | 0.0081 | 0.3889 | 7.1 | 8f5z:B, 8f5z:A, 8iff:B, 8isj:A, 8isj:B |
| 11 | 8ibd:AB | 418 | 54 | 0.2459 | 0.0359 | 0.2778 | 7.3 | 8iao:Ab, 8iar:Ab, 8ibd:Ab, 8ibg:AB, 8ibg:Ab |
| 12 | 6mat:A | 578 | 38 | 0.2295 | 0.0242 | 0.3684 | 9.1 | 6mat:C, 6mat:E, 6mat:B, 6mat:D, 6mat:F, 7swl:A, 7swl:B, 7swl:C, 7swl:D, 7t0v:A, 7t0v:B, 7t0v:C, 7t0v:D, 7t0v:E, 7t0v:F, 7t3i:A, 7t3i:B, 7t3i:C, 7t3i:E, 7t3i:D |
umich.edu