WSYSQTLSANIQVNALQRYQEMIGGGCSGAFGWACQQFPTGLTPENQEEVTKILFDENIGGLSIVRNDIGSSPGSTILPT
The query sequence (length=445) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8idp:A |
446 |
446 |
1.0000 |
0.9978 |
0.9978 |
0.0 |
8idp:C, 8idp:B, 8idp:D, 8idq:A, 8idq:B, 8idq:C, 8idq:D |
2 |
6krn:A |
456 |
452 |
0.3910 |
0.3816 |
0.3850 |
8.97e-89 |
|
3 |
8cbc:A |
455 |
456 |
0.3596 |
0.3516 |
0.3509 |
4.70e-74 |
8c48:A, 8c48:B, 8cbc:B, 7o0e:A, 7o0e:G, 8p67:A, 8p67:B |
4 |
6m5z:A |
433 |
436 |
0.3551 |
0.3649 |
0.3624 |
1.62e-72 |
6m5z:B |
5 |
7n6o:A |
433 |
456 |
0.2742 |
0.2818 |
0.2675 |
1.50e-27 |
7n6o:B |
6 |
5ngl:B |
454 |
416 |
0.2337 |
0.2291 |
0.2500 |
4.44e-18 |
5ngl:A, 5ngl:C |
7 |
2y24:A |
383 |
354 |
0.2000 |
0.2324 |
0.2514 |
2.11e-13 |
|
8 |
4uqa:A |
391 |
336 |
0.1843 |
0.2097 |
0.2440 |
1.53e-11 |
5a6l:A, 5a6m:A, 4ckq:A, 4uqc:A |
9 |
4qaw:A |
537 |
335 |
0.1820 |
0.1508 |
0.2418 |
2.09e-11 |
4qaw:B, 4qaw:C, 4qaw:D, 4qaw:E, 4qaw:F, 4qaw:G, 4qaw:H, 4qb1:A, 4qb2:A, 4qb6:A |
10 |
3kl0:A |
397 |
349 |
0.1933 |
0.2166 |
0.2464 |
1.89e-09 |
3kl3:A, 3kl3:B, 3kl5:A, 3kl5:B, 3kl5:C |
11 |
2wnw:B |
445 |
80 |
0.0629 |
0.0629 |
0.3500 |
5.69e-07 |
2wnw:A |
12 |
9fa6:A |
501 |
437 |
0.2112 |
0.1876 |
0.2151 |
1.95e-06 |
8awk:AAA, 8awr:AAA, 8ax3:A, 8ax3:B, 9f9z:A, 9fa3:A, 9fad:A, 9fal:A, 9fay:A, 9faz:A, 9fb2:A, 9fdi:A, 3gxf:B, 3gxf:D, 5lvx:C, 5lvx:B, 5lvx:A, 5lvx:D, 6moz:A, 2nsx:A, 2nsx:B, 2nsx:C, 2nsx:D, 2nt0:A, 2nt0:B, 2nt0:C, 2nt0:D, 7nwv:AAA, 7nwv:BBB, 8p3e:B, 8p41:A, 8p41:B, 6q1n:A, 6q1n:B, 6q1p:A, 6q1p:B, 6q6k:A, 6q6k:B, 6q6l:A, 6q6l:B, 6q6n:A, 6q6n:B, 3rik:B, 3rik:D, 3ril:A, 3ril:B, 3ril:C, 3ril:D, 6t13:B, 6t13:C, 6t13:A, 6t13:D, 6tjq:BBB, 6tn1:AAA, 2v3d:A, 2v3d:B, 2v3e:A, 2v3e:B, 2vt0:A, 2vt0:B, 2wcg:A, 2wcg:B, 2xwd:A, 2xwd:B, 2xwe:A, 2xwe:B, 1y7v:A, 1y7v:B, 6ytp:AAA, 6ytp:BBB, 6ytr:AAA, 6ytr:BBB, 6yut:AAA, 6yut:BBB, 6yv3:AAA, 6yv3:BBB, 6z39:AAA, 6z39:BBB, 6z3i:BBB |
13 |
5nxb:A |
644 |
145 |
0.0854 |
0.0590 |
0.2621 |
0.027 |
4ccc:A, 4ccd:A, 4cce:A, 5nxb:B, 4ufh:A, 4ufi:A, 4ufj:A, 4ufk:A, 4ufl:A, 4ufm:A, 6y6s:A, 6y6t:A, 3zr5:A, 3zr6:A |
14 |
5agd:B |
344 |
69 |
0.0517 |
0.0669 |
0.3333 |
0.40 |
5agd:A, 4boj:A, 4boj:B, 4boj:C, 4d4b:A, 4d4b:B, 4d4c:A, 4d4c:B, 4d4d:A, 4d4d:B, 5m77:A, 5m77:B, 5n0f:A, 5n0f:B, 7nl5:A, 6zbm:A, 6zbw:A, 6zbw:B, 6zbx:A, 6zbx:B |
15 |
7whg:G |
221 |
54 |
0.0472 |
0.0950 |
0.3889 |
0.52 |
|
16 |
7u0e:H |
224 |
204 |
0.1101 |
0.2188 |
0.2402 |
2.0 |
7u0e:A |
17 |
7o4x:A |
103 |
24 |
0.0247 |
0.1068 |
0.4583 |
2.9 |
|
18 |
7mi4:A |
554 |
159 |
0.0944 |
0.0758 |
0.2642 |
3.0 |
7mi4:B, 7mi4:C, 7mi4:D, 7mi5:A, 7mi5:B, 7mi5:D, 7mi5:C, 7mi9:A, 7mi9:B, 7mi9:C, 7mi9:D, 7mib:A, 7mib:B, 7mib:C, 7mib:D, 7mid:A, 7mid:B |
19 |
7lsu:A |
765 |
81 |
0.0517 |
0.0301 |
0.2840 |
5.5 |
7lsa:A, 7lsr:A, 7lst:A |
20 |
5e6f:A |
130 |
23 |
0.0247 |
0.0846 |
0.4783 |
6.8 |
5e6f:B |
21 |
5a6q:A |
114 |
50 |
0.0360 |
0.1404 |
0.3200 |
7.1 |
5a6q:B, 5a6q:C, 5a6q:D, 5a6x:A, 5a6x:B, 5a6x:C, 5a6x:D, 5a6y:B, 5a6y:C, 5a6y:D, 5a6y:A, 5a6z:A, 5a6z:B, 5a6z:C, 5a6z:D, 5a70:A, 5a70:B, 5a70:C, 5a70:D, 5may:A, 5may:B, 5may:C, 5may:D, 5maz:A, 5maz:B, 5maz:C, 5maz:D, 5mb1:A, 5mb1:B, 5mb1:C, 5mb1:D, 4ut5:A, 4ut5:B, 4ut5:C, 4ut5:D |