WSLRWRMQKSTTIAAIAGCSGAATFGGLAGGIVGCIAAGILAILQGFEVNWHNGGGGDRSNPV
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1kvd:A | 63 | 63 | 1.0000 | 1.0000 | 1.0000 | 4.90e-40 | 1kvd:C |
2 | 2h12:B | 426 | 34 | 0.2222 | 0.0329 | 0.4118 | 3.5 | 2h12:A, 2h12:C, 2h12:D, 2h12:E, 2h12:F |
3 | 6xut:A | 589 | 33 | 0.1905 | 0.0204 | 0.3636 | 5.1 | 6xuu:A, 6xuv:A |
4 | 4brs:A | 342 | 52 | 0.2540 | 0.0468 | 0.3077 | 5.8 | 4btv:A, 4btv:B, 2x5x:A |
5 | 8pn9:D | 110 | 42 | 0.1587 | 0.0909 | 0.2381 | 6.0 | 6s7o:D, 6s7t:D |
6 | 6h3o:F | 650 | 35 | 0.2063 | 0.0200 | 0.3714 | 6.3 | 6h3g:A, 6h3g:B, 6h3g:C, 6h3g:F, 6h3g:D, 6h3g:E, 6h3g:G, 6h3g:H, 6h3o:A, 6h3o:B, 6h3o:C, 6h3o:D, 6h3o:E, 6h3o:G, 6h3o:H, 8il5:A |
7 | 3aj3:A | 273 | 21 | 0.1429 | 0.0330 | 0.4286 | 6.4 | 4kep:A, 4keq:A |
8 | 1ja9:A | 259 | 50 | 0.2857 | 0.0695 | 0.3600 | 8.0 | |
9 | 3aw5:A | 438 | 9 | 0.1111 | 0.0160 | 0.7778 | 8.6 | 6k3d:A, 8p4g:A, 8p4g:B |
10 | 3qfe:A | 305 | 35 | 0.2222 | 0.0459 | 0.4000 | 9.0 | |
11 | 6deb:B | 284 | 24 | 0.1111 | 0.0246 | 0.2917 | 9.4 | 3p2o:A, 3p2o:B |