BioLiP

>protein
WPYFIIDLYHWDKHTQKEKGKIALQVNQSYGLLRDYFELAVTWANEEFREMFHGPLDRITTYGGPTSEFLKENGINEVVL
LDPWAEEVLSEKDFDVKAFIIGGIVDTNKKKTTPKIGEELESAGIKVRRRKIVLRGDVVGVPDRINRILGIILKMMVEGK
SMDEAVYEMQ

The query sequence (length=170) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6emu:A	170	170	1.0000	1.0000	1.0000	1.34e-124	6emu:B, 6emu:C, 6emv:A, 6emv:B, 6emv:C
2	5a7y:B	278	174	0.2765	0.1691	0.2701	6.28e-11	5a7y:A
3	4jwf:A	187	178	0.2412	0.2193	0.2303	2.6	4jwf:B, 4jwh:A, 4jwh:B
4	7etl:A	294	71	0.1353	0.0782	0.3239	2.7	7de0:B, 7de0:A, 7de0:C, 7de0:D, 7etk:A, 7etk:B, 7etl:B, 6oxh:A, 6oxh:B, 6oxj:A, 6oxj:B, 7wsb:A, 7wsb:B, 7wsb:C, 7wsb:D, 7wsb:E, 7wsb:F, 4y5s:A, 4y5s:B, 4y5t:A, 4y5t:B
5	4dxg:A	194	30	0.0647	0.0567	0.3667	5.4	4rco:A, 4rco:B
6	8ot8:A	412	39	0.0765	0.0316	0.3333	5.8	8ot8:B, 8ot8:C, 8ot8:D
7	5cr9:A	290	116	0.1647	0.0966	0.2414	6.1
8	4yb6:A	296	57	0.1235	0.0709	0.3684	6.3	5ub9:A, 5ub9:B, 5ubg:A, 5ubg:B, 5ubh:A, 5ubh:B, 5ubi:A, 5ubi:B, 4yb5:A, 4yb5:E, 4yb5:B, 4yb5:C, 4yb5:F, 4yb5:D, 4yb6:E, 4yb6:B, 4yb6:C, 4yb6:F, 4yb6:D, 4yb7:B, 4yb7:C, 4yb7:D, 4yb7:E, 4yb7:I, 4yb7:K, 4yb7:A, 4yb7:F, 4yb7:G, 4yb7:H, 4yb7:J, 4yb7:L
9	3hwr:A	299	25	0.0588	0.0334	0.4000	6.7	3hwr:B
10	3ajz:A	132	30	0.0471	0.0606	0.2667	6.7	3ak0:A, 3ak0:B
11	5i4d:B	193	29	0.0647	0.0570	0.3793	6.7	5i4d:A
12	4fmw:A	178	45	0.0941	0.0899	0.3556	7.2	4fmw:B
13	3jyu:B	216	30	0.0647	0.0509	0.3667	7.5
14	3r6k:A	301	30	0.0706	0.0399	0.4000	7.8
15	6yo9:A	398	44	0.0765	0.0327	0.2955	9.2	6twk:A, 6twk:B, 6yo9:B
16	4jwj:A	193	140	0.1941	0.1710	0.2357	9.8	4jwj:B

[Back]