WPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHR
The query sequence (length=280) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8ow4:B |
296 |
280 |
1.0000 |
0.9459 |
1.0000 |
0.0 |
1a02:N, 2as5:N, 2as5:M, 2o93:L, 2o93:M, 2o93:O, 1owr:M, 1owr:N, 1owr:P, 1owr:Q, 1p7h:L, 1p7h:M, 1p7h:N, 1p7h:O, 1pzu:L, 1pzu:M, 1pzu:H, 1pzu:I, 1pzu:B, 1pzu:D, 3qrf:N, 8r3f:A, 8r3f:B, 1s9k:C |
2 |
8ow4:A |
225 |
273 |
0.7857 |
0.9778 |
0.8059 |
6.21e-146 |
|
3 |
1a66:A |
178 |
175 |
0.5107 |
0.8034 |
0.8171 |
3.36e-106 |
|
4 |
1imh:C |
281 |
280 |
0.4321 |
0.4306 |
0.4321 |
2.94e-70 |
1imh:D |
5 |
6c49:A |
338 |
79 |
0.0857 |
0.0710 |
0.3038 |
0.087 |
|
6 |
3t37:A |
509 |
69 |
0.0679 |
0.0373 |
0.2754 |
0.81 |
4ha6:A |
7 |
7uy2:A |
175 |
29 |
0.0464 |
0.0743 |
0.4483 |
1.8 |
5ljn:A, 5ljn:B, 4oyk:A, 4oyk:B, 4p0a:A, 4p0a:C, 4p0b:A, 4p0b:C, 7uy2:B, 7uyj:A, 7uyj:B |
8 |
7dco:L |
435 |
111 |
0.1107 |
0.0713 |
0.2793 |
1.8 |
|
9 |
3t6q:A |
601 |
115 |
0.1036 |
0.0483 |
0.2522 |
2.2 |
3t6q:B |
10 |
6j6g:c |
436 |
88 |
0.0857 |
0.0550 |
0.2727 |
4.5 |
6j6h:c, 6j6n:c, 6j6q:c, 5y88:J, 5ylz:J |
11 |
6a4y:A |
595 |
46 |
0.0679 |
0.0319 |
0.4130 |
4.7 |
5b72:A, 3bxi:A, 7c73:A, 7c74:A, 7c75:A, 7d52:A, 7dao:A, 7de5:A, 7dlq:A, 7dmr:A, 7dn6:A, 7dn7:A, 2e9e:A, 2e9e:B, 2efb:A, 2efb:B, 2eha:A, 2eha:B, 3erh:A, 3eri:A, 3faq:A, 5ff1:A, 5ff1:B, 3fnl:A, 3gc1:A, 3gcj:A, 3gck:A, 3gcl:A, 5gh0:A, 2gjm:A, 5gls:A, 4gm7:A, 5hpw:A, 5hpw:B, 5hpw:C, 5hpw:D, 3i6n:A, 2ikc:A, 2ikc:B, 8ing:A, 2ips:A, 9it8:A, 8k5m:A, 6kmk:A, 3krq:A, 4ksz:A, 6ky7:A, 6l2j:A, 6l32:A, 6l5g:A, 6l9t:A, 6lco:A, 6lf7:A, 6lqw:A, 6lqw:B, 6m7e:A, 4msf:A, 3n8f:A, 3n8f:B, 3nak:A, 3nak:B, 3niu:A, 3niu:B, 4njb:A, 2nqx:A, 2o86:A, 4oek:A, 2ojv:A, 4pnx:A, 2pt3:A, 2pum:A, 3py4:A, 3qf1:A, 4qjq:A, 2qpk:A, 2qqt:A, 2qrb:A, 3r4x:A, 2r5l:A, 3r55:A, 3r5o:A, 3rke:A, 3sxv:A, 3tgy:A, 3uba:A, 3v6q:A, 7ve3:A, 5wv3:A, 7wyj:A, 7y3u:A, 7y3u:B, 4y55:A, 8y9x:A, 2z5z:A, 5zgs:A |
12 |
1vix:A |
411 |
40 |
0.0500 |
0.0341 |
0.3500 |
5.7 |
1fno:A, 1vix:B |
13 |
3ah7:A |
109 |
85 |
0.0821 |
0.2110 |
0.2706 |
9.7 |
|