WNKKGKVNEATVQARKEKKRLKETNQFTGDYTGERPPHPWLSAKRLRSIMTQYQVFANKNRLNIKVDKKDAVEMKKQFEE
IGAHEYYRMRTEQIINEKNNQVIDQINKEIETLPFNIYEEITKMPKDKIYNFNTDSNSPYILYFEQIARMFDEEHLTKLK
VSQRLQKLAEDKLGEND
The query sequence (length=177) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6z1p:AH | 177 | 177 | 1.0000 | 1.0000 | 1.0000 | 4.17e-131 | |
2 | 3cpm:A | 184 | 69 | 0.1073 | 0.1033 | 0.2754 | 0.77 | 3m6o:A, 3m6o:B, 3m6p:A, 3m6p:B, 3m6q:A, 3m6r:A, 3m6r:B, 3m6r:C, 3m6r:D, 3o3j:A, 3pn2:A, 3pn3:A, 3pn3:B, 3pn4:A, 3pn5:A, 3pn6:A, 3pn6:B |
3 | 5v8f:E | 422 | 62 | 0.1073 | 0.0450 | 0.3065 | 3.1 | 6wgc:E, 6wgg:E, 6wgi:E |
4 | 7tjh:E | 439 | 62 | 0.1073 | 0.0433 | 0.3065 | 4.0 | 7tji:E, 7tjj:E, 7tjk:E |
5 | 5zr1:E | 460 | 62 | 0.1073 | 0.0413 | 0.3065 | 4.1 | 7mca:E, 6rqc:E, 7tjf:E |
6 | 1q19:A | 500 | 87 | 0.1017 | 0.0360 | 0.2069 | 5.9 | 1q19:B, 1q19:C, 1q19:D |