WLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPTGHQSKEELGRAMQVAKVSTASVGRF
QERLPKEKVKKRKFQPLFGDFAAEKKNQLELLRVMN
The query sequence (length=116) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8fkx:ST | 148 | 121 | 1.0000 | 0.7838 | 0.9587 | 2.46e-79 | 8fkt:ST, 8fku:ST, 8fkv:ST, 8fkw:ST, 8fky:ST |
2 | 8fl0:ST | 199 | 44 | 0.3793 | 0.2211 | 1.0000 | 1.35e-24 | 8ir1:R, 8ir3:R |
3 | 7v6c:B | 260 | 118 | 0.2759 | 0.1231 | 0.2712 | 0.74 | |
4 | 4gy5:A | 215 | 40 | 0.1034 | 0.0558 | 0.3000 | 3.3 | 3ask:A, 3ask:B, 3ask:D, 3asl:A, 3db3:A, 7fb7:B, 4gy5:B, 6iiw:A, 2lgg:A, 2lgk:A, 2lgl:A, 4qqd:A, 4qqd:B, 3shb:A, 3sou:A, 3sou:B, 3sow:A, 3sow:B, 3sox:A, 3sox:B, 3t6r:B, 3t6r:A, 8wms:A, 5xpi:A, 5yy9:A, 5yy9:B, 3zvy:A, 3zvy:B, 3zvz:B |
5 | 7oya:M1 | 134 | 33 | 0.1034 | 0.0896 | 0.3636 | 6.8 | 7oyb:M1 |
6 | 3cea:A | 342 | 57 | 0.1293 | 0.0439 | 0.2632 | 7.5 | 3cea:B, 3cea:C, 3cea:D |