WGNLGHETVAYIAQSFVASSTESFCQNILGDDSTSYLANVATWANTYKYTDAGEFSKPYHFIDAQDNPPQSCGVDYDRDC
GSAGCSISAIQNYTNILLESPNGSEALNALKFVVHIIGDIHQPLHDENLEAGGNGIDVTYDGETTNLHHIWDTNMPEEAA
GGYSLSVAKTYADLLTERIKTGTYSSKKDSWTDGIDIKDPVSTSMIWAADANTYVCSTVLDDGLAYINSTDLSGEYYDKS
QPVFEELIAKAGYRLAAWLDLIASQ
The query sequence (length=265) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5fb9:A | 267 | 265 | 0.9962 | 0.9888 | 0.9962 | 0.0 | 5fb9:B, 5fba:A, 5fbb:A, 5fbb:B, 5fbc:A, 5fbd:A, 5fbf:A, 5fbg:A, 5fbg:B, 7qta:A, 7qta:B, 7qtb:A, 7qtb:B |
2 | 1ak0:A | 264 | 263 | 0.4981 | 0.5000 | 0.5019 | 3.14e-82 | |
3 | 4cxv:A | 258 | 276 | 0.3283 | 0.3372 | 0.3152 | 3.76e-31 | 4cwm:A, 4cwm:B, 4cxo:A, 4cxp:A, 4cxv:B, 3w52:A |
4 | 3sng:A | 267 | 272 | 0.2755 | 0.2734 | 0.2684 | 1.50e-25 | 4dj4:A, 4dj4:B, 4jdg:A |
5 | 8qjp:A | 250 | 267 | 0.2755 | 0.2920 | 0.2734 | 7.31e-25 | 8qjl:A, 8qjm:A, 8qjm:B, 8qjn:A, 8qjn:B, 8qjo:A, 8qjo:B, 8qjp:B, 8qjq:A, 8qjq:B |
6 | 7l07:A | 214 | 45 | 0.0642 | 0.0794 | 0.3778 | 0.26 | |
7 | 5zvq:A | 194 | 50 | 0.0642 | 0.0876 | 0.3400 | 0.27 | 8ab0:F, 8ab0:E, 8bpr:E, 8bpr:F |
8 | 4kcf:A | 407 | 75 | 0.0830 | 0.0541 | 0.2933 | 0.85 | 3m9v:A |
9 | 5iki:B | 399 | 63 | 0.0755 | 0.0501 | 0.3175 | 1.3 | 5iki:A, 5xnt:A, 4yt3:A, 4yt3:B |
10 | 9c9y:A | 612 | 62 | 0.0792 | 0.0343 | 0.3387 | 3.9 | 9ca0:A, 9ca1:A |
11 | 8fy5:A | 387 | 26 | 0.0377 | 0.0258 | 0.3846 | 6.9 | 8fy5:B, 8fyf:A, 8fyf:B |
12 | 4n4r:C | 533 | 73 | 0.0792 | 0.0394 | 0.2877 | 7.2 | 4n4r:A |
13 | 1k3i:A | 651 | 38 | 0.0528 | 0.0215 | 0.3684 | 9.5 | 2eib:A, 2eic:A, 2eid:A, 2eie:A, 1gof:A, 1gog:A, 2jkx:A, 1t2x:A, 8tx5:A, 8tx5:B, 8tx5:C, 8tx5:D, 8tx6:A, 2vz1:A, 2vz3:A, 2wq8:A, 6xlr:A, 6xls:A, 6xlt:A |