BioLiP Library

>protein
WDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLPITRGPQQPPKLGPRGKI

The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7wfd:AH	95	75	0.9067	0.7158	0.9067	1.10e-44	8j6z:H, 8j7a:H, 8j7b:H, 2o01:H, 7wfe:BH, 7wg5:AH, 2wsc:H, 2wse:H, 2wsf:H
2	4xk8:H	90	75	0.8667	0.7222	0.8667	3.06e-42	4xk8:h
3	6yez:H	93	72	0.8000	0.6452	0.8333	7.83e-39	7dkz:H, 5l8r:H, 3lw5:H, 4rku:H, 4y28:H, 6yac:H, 6zoo:H, 6zxs:H
4	8htu:H	95	74	0.5600	0.4421	0.5676	1.62e-28	7ksq:H, 7kux:H, 6l35:H, 7xqp:H
5	8wgh:H	90	75	0.7867	0.6556	0.7867	5.22e-21
6	5zji:H	95	75	0.8267	0.6526	0.8267	4.04e-20	8bcv:H, 8bcw:H
7	6zzx:H	94	75	0.4267	0.3404	0.4267	2.16e-16	6zzy:H
8	7yca:H	96	76	0.4133	0.3229	0.4079	3.39e-08
9	7d0j:H	100	76	0.3467	0.2600	0.3421	6.80e-08	7dz7:H, 7dz8:H, 8h2u:H, 6ijo:H
10	6igz:H	88	74	0.4133	0.3523	0.4189	9.77e-08
11	6sl5:H	92	77	0.3200	0.2609	0.3117	1.95e-04
12	6tq4:A	297	30	0.1867	0.0471	0.4667	0.20	6tq6:A
13	7xrr:A	309	30	0.1867	0.0453	0.4667	0.21	7l1u:R, 7l1v:R, 7sqo:R, 7sr8:R
14	6tpn:A	510	30	0.1867	0.0275	0.4667	0.22	4s0v:A, 6tpg:A, 6tpj:A, 6tpj:B, 5wqc:A, 5ws3:A
15	6tp3:A	314	30	0.1867	0.0446	0.4667	0.22	6to7:A, 6to7:B, 6tod:A, 6tod:B, 6tos:A, 6tos:B, 6tot:A, 6tot:B, 6tp3:B, 6tp4:A, 6tp4:B, 6tp6:A, 6tp6:B, 6tq4:B, 6tq6:B, 6tq7:A, 6tq7:B, 6tq9:A, 6tq9:B
16	6v9s:A	503	29	0.1867	0.0278	0.4828	0.34	4zj8:A, 4zjc:A
17	5v1d:A	193	70	0.2533	0.0984	0.2714	3.2
18	5i4e:A	959	21	0.1467	0.0115	0.5238	3.5
19	5v1d:D	247	61	0.2533	0.0769	0.3115	3.9	5v1d:C
20	5wvp:A	924	43	0.2000	0.0162	0.3488	7.8
21	2ap1:A	305	34	0.1333	0.0328	0.2941	8.9
22	7tt7:D	102	48	0.1867	0.1373	0.2917	8.9
23	4o4y:H	215	54	0.2533	0.0884	0.3519	8.9	5dmg:C, 5dmg:H, 5dmg:E, 4o51:H, 4o51:B, 4o51:D, 4o51:F
24	8bo1:B	398	65	0.2667	0.0503	0.3077	9.8	8bo1:D, 8br0:B, 8br0:D, 8br1:B, 8br1:D

[Back]