BioLiP

>protein
VYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAF
ILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEV
MYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSK
WTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGD

The query sequence (length=292) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ap2:A	300	291	0.9966	0.9700	1.0000	0.0	3ap1:A, 3ap1:B, 3ap2:B, 3ap3:A, 3ap3:B, 3ap3:C, 3ap3:D
2	5wrj:A	275	274	0.7329	0.7782	0.7810	3.39e-167	5wri:A, 5wri:B, 5wrj:B, 5wrj:C, 5wrj:D
3	8w5z:A	333	289	0.6815	0.5976	0.6886	1.76e-152	8w5z:C
4	4gbm:A	283	279	0.2363	0.2438	0.2473	1.41e-11
5	4gox:A	275	216	0.1918	0.2036	0.2593	3.04e-11
6	5o96:D	243	119	0.0993	0.1193	0.2437	0.18	5o96:A, 5o96:B, 5o96:C, 5o96:E, 5o96:F, 5o96:G, 5o96:H
7	1t8t:B	271	209	0.1541	0.1661	0.2153	0.70	1t8t:A, 1t8u:B, 1t8u:A, 6xkg:A, 6xkg:B, 6xl8:A, 6xl8:B
8	3n0y:A	176	68	0.0651	0.1080	0.2794	2.1	3n0y:B, 3n0z:A, 3n0z:B, 3n10:A, 3n10:B
9	7er1:A	303	60	0.0719	0.0693	0.3500	2.4
10	7qv7:S	571	92	0.0788	0.0403	0.2500	2.8	7qv7:Y
11	5bn4:A	567	81	0.0651	0.0335	0.2346	3.5	5bn3:A
12	8swy:A	248	101	0.0822	0.0968	0.2376	5.1	8swy:B, 8swz:A, 8swz:B
13	8hi7:B	295	49	0.0479	0.0475	0.2857	5.2	8hi8:B
14	6skf:BV	154	67	0.0548	0.1039	0.2388	6.8	6skg:BV, 6th6:BV
15	6qp0:A	188	34	0.0479	0.0745	0.4118	7.1
16	2z6v:A	392	55	0.0685	0.0510	0.3636	8.5
17	3mhx:B	81	27	0.0342	0.1235	0.3704	8.7
18	3q2i:A	345	90	0.0616	0.0522	0.2000	9.2
19	4fmc:F	73	28	0.0342	0.1370	0.3571	9.4

[Back]