VYEGKAKKMIPIDDDKLIMEFKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMY
PLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLGISLDEIKKIEEIALKVNEILKDYLAK
KGIILVDFKLEFGKDKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKPEF
The query sequence (length=232) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4o7n:A | 233 | 232 | 1.0000 | 0.9957 | 1.0000 | 1.31e-167 | 4o7l:A, 4o7r:A, 4o7s:A, 4o7t:A, 4o7v:A, 4o7w:A, 4o7y:A, 4o7z:A, 4o81:A, 4o81:B, 4o82:A, 4o82:B, 4o83:A, 4o83:B, 4o84:A, 4o84:B, 4o86:A, 3u54:A, 3u54:B |
2 | 3nua:B | 237 | 227 | 0.5172 | 0.5063 | 0.5286 | 2.75e-78 | 3nua:A |
3 | 2z02:A | 242 | 226 | 0.5216 | 0.5000 | 0.5354 | 1.39e-77 | 2yzl:A, 2z02:B |
4 | 2ywv:A | 237 | 230 | 0.5129 | 0.5021 | 0.5174 | 8.79e-75 | 2ywv:B |
5 | 4fe2:B | 235 | 227 | 0.4612 | 0.4553 | 0.4714 | 3.17e-64 | 4fe2:A, 4fgr:A, 4fgr:B, 4nye:A, 4nye:B |
6 | 2gqr:A | 237 | 227 | 0.4181 | 0.4093 | 0.4273 | 3.70e-57 | 2gqr:B, 2gqs:A, 2gqs:B |
7 | 7ale:A | 419 | 217 | 0.3190 | 0.1766 | 0.3410 | 5.57e-28 | 7ale:B, 6yb8:A, 6yb8:B, 6yb9:A, 6yb9:B |
8 | 1obg:A | 305 | 252 | 0.3276 | 0.2492 | 0.3016 | 6.37e-22 | 2cnq:A, 2cnu:A, 2cnv:A, 1obd:A |
9 | 6yx3:A | 297 | 279 | 0.3448 | 0.2694 | 0.2867 | 9.73e-21 | 6yy6:A, 6yy7:A, 6yy8:A, 6yy9:A, 6yya:A, 6yyb:A, 6yyc:A, 6yyd:A, 6z0q:A, 6z0r:A |
10 | 3l2n:A | 376 | 96 | 0.0991 | 0.0612 | 0.2396 | 0.53 | 3l2n:B |
11 | 8i9r:Cg | 233 | 58 | 0.0776 | 0.0773 | 0.3103 | 1.2 | 8i9t:Cg |
12 | 1ynp:B | 298 | 100 | 0.1293 | 0.1007 | 0.3000 | 1.9 | 1ynp:A, 1ynq:A, 1ynq:B |
13 | 7d80:5 | 432 | 27 | 0.0517 | 0.0278 | 0.4444 | 2.3 | 7d6z:h, 1w2b:5 |
14 | 5lu4:A | 850 | 28 | 0.0560 | 0.0153 | 0.4643 | 3.3 | 5lu4:B |
15 | 5jvl:A | 874 | 28 | 0.0560 | 0.0149 | 0.4643 | 3.3 | 5jvj:A, 5jvl:C, 5jvl:D, 5jvn:A |
16 | 5th5:A | 241 | 79 | 0.0819 | 0.0788 | 0.2405 | 4.5 | 5tgs:A, 5tgs:B, 5th5:B, 5th5:C, 5th5:D |
17 | 3l76:A | 585 | 59 | 0.0690 | 0.0274 | 0.2712 | 4.9 | 3l76:B |
18 | 9bh5:Cd | 105 | 50 | 0.0690 | 0.1524 | 0.3200 | 7.5 | 9cai:Cd |
19 | 4prl:A | 330 | 85 | 0.0948 | 0.0667 | 0.2588 | 7.7 | 4prl:B |
20 | 4epm:A | 554 | 69 | 0.0733 | 0.0307 | 0.2464 | 7.8 | 4eq4:A, 4eq4:B, 4eql:A, 4eql:B, 4l39:A, 4l39:B, 6oms:A, 6oms:B |
21 | 4ewv:B | 492 | 69 | 0.0733 | 0.0346 | 0.2464 | 8.0 | 4ewv:A |
22 | 4pet:A | 329 | 55 | 0.0819 | 0.0578 | 0.3455 | 8.1 | 4pet:B |