VWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQA
AKDKALQSMAA
The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5gzb:A | 91 | 91 | 1.0000 | 1.0000 | 1.0000 | 2.89e-63 | 5nnx:A, 5no6:N, 5no6:I |
2 | 3r2q:A | 202 | 34 | 0.1099 | 0.0495 | 0.2941 | 0.81 | |
3 | 7uoi:A | 383 | 31 | 0.1538 | 0.0366 | 0.4516 | 4.0 | 8vkt:A |
4 | 6ks6:Q | 548 | 33 | 0.1429 | 0.0237 | 0.3939 | 5.1 | 6ks6:q, 4v81:H, 4v81:P, 4v81:h, 4v81:p, 4v8r:AQ, 4v8r:Aq, 4v8r:BQ, 4v8r:Bq, 4v94:H, 4v94:P, 4v94:h, 4v94:p, 7ylw:Q, 7ylw:q, 7ylx:Q, 7ylx:q, 7yly:Q, 7yly:q |
5 | 2v95:A | 342 | 58 | 0.1868 | 0.0497 | 0.2931 | 5.9 | |
6 | 6rxt:UR | 447 | 34 | 0.1429 | 0.0291 | 0.3824 | 9.1 | 5oql:N, 6rxu:UR, 6rxv:UR, 6rxy:UR, 6rxz:UR |
7 | 7tz4:A | 530 | 43 | 0.1648 | 0.0283 | 0.3488 | 9.3 | 7tyb:A |