BioLiP

>protein
VWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPII
GRTAAQCLEHYEFLLDKAA

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8i0s:L	169	99	1.0000	0.5858	1.0000	2.66e-70
2	5mqf:L	336	99	1.0000	0.2946	1.0000	1.20e-69
3	8ch6:P	330	99	1.0000	0.3000	1.0000	1.28e-69	8i0t:L, 7qtt:P
4	8i0u:L	387	99	1.0000	0.2558	1.0000	4.04e-69	8i0v:L
5	6qdv:O	441	99	1.0000	0.2245	1.0000	6.78e-69	7w59:L, 7w5a:L, 7w5b:L
6	5z56:L	342	99	1.0000	0.2895	1.0000	7.17e-69	5z57:L, 5z58:L
7	8i0w:L	419	99	1.0000	0.2363	1.0000	1.77e-68	5yzg:L
8	6icz:L	454	99	1.0000	0.2181	1.0000	2.25e-68	5xjc:L
9	6id0:L	475	99	1.0000	0.2084	1.0000	3.08e-68	6id1:L
10	9fmd:L	555	99	1.0000	0.1784	1.0000	1.44e-67	8c6j:O, 7dvq:L, 6ff4:L, 8i0p:L, 8i0r:L, 6zym:L
11	8ro2:L	555	99	1.0000	0.1784	1.0000	1.92e-67	7abi:L
12	8ro1:L	623	98	0.8889	0.1413	0.8980	1.03e-60	8ro0:L
13	3jb9:W	426	96	0.8081	0.1878	0.8333	1.41e-54
14	7b9v:O	280	96	0.5253	0.1857	0.5417	4.48e-33
15	5lj5:O	283	96	0.5253	0.1837	0.5417	7.01e-33
16	6exn:O	320	96	0.5253	0.1625	0.5417	1.19e-32	6bk8:S
17	7dco:L	435	96	0.5253	0.1195	0.5417	4.73e-32
18	5gm6:c	415	96	0.5253	0.1253	0.5417	6.36e-32
19	6j6g:c	436	95	0.5253	0.1193	0.5474	7.76e-32	6j6h:c, 6j6n:c, 6j6q:c, 5y88:J, 5ylz:J
20	5gmk:c	436	95	0.5253	0.1193	0.5474	1.11e-31	5lj3:O, 5mps:O, 5mq0:O, 5wsg:c
21	3zqc:J	119	79	0.3030	0.2521	0.3797	1.68e-14	3zqc:A, 3zqc:D, 3zqc:G
22	3zqc:J	119	40	0.1414	0.1176	0.3500	5.4	3zqc:A, 3zqc:D, 3zqc:G
23	6kks:A	106	99	0.3333	0.3113	0.3333	1.03e-13
24	1h88:C	152	95	0.3333	0.2171	0.3474	1.24e-13	1h89:C, 1h8a:C, 1mse:C, 1msf:C
25	1h88:C	152	97	0.3434	0.2237	0.3505	4.78e-13	1h89:C, 1h8a:C, 1mse:C, 1msf:C
26	1h88:C	152	48	0.1919	0.1250	0.3958	0.037	1h89:C, 1h8a:C, 1mse:C, 1msf:C
27	3osg:A	110	79	0.3232	0.2909	0.4051	3.02e-12	3osf:A, 3osf:D, 3osg:D
28	2kdz:A	107	54	0.2020	0.1869	0.3704	3.22e-09
29	2kdz:A	107	40	0.1212	0.1121	0.3000	3.4
30	5eyb:A	340	103	0.3434	0.1000	0.3301	2.11e-07	5eyb:B
31	8ity:4	365	95	0.3333	0.0904	0.3474	3.77e-07	8iue:4, 8iuh:4
32	8ity:4	365	78	0.2828	0.0767	0.3590	2.83e-06	8iue:4, 8iuh:4
33	8ity:4	365	98	0.3232	0.0877	0.3265	1.93e-05	8iue:4, 8iuh:4
34	8ity:4	365	102	0.2929	0.0795	0.2843	0.012	8iue:4, 8iuh:4
35	7xur:A	307	95	0.3333	0.1075	0.3474	3.78e-07
36	7xur:A	307	106	0.3535	0.1140	0.3302	5.28e-06
37	7xur:A	307	98	0.3232	0.1042	0.3265	1.61e-05
38	7xur:A	307	102	0.2929	0.0945	0.2843	0.009
39	7zwc:c	303	76	0.2828	0.0924	0.3684	2.04e-06	7zwd:c, 7zx7:c, 7zx8:c, 7zxe:c
40	7zwc:c	303	69	0.2222	0.0726	0.3188	0.011	7zwd:c, 7zx7:c, 7zx8:c, 7zxe:c
41	4a69:C	69	42	0.1414	0.2029	0.3333	0.14	4a69:D
42	8ox1:M	65	40	0.1717	0.2615	0.4250	0.20	1iv6:A, 8ox1:L, 1w0t:A, 1w0t:B
43	7c4p:A	55	43	0.1616	0.2909	0.3721	0.22	7c4p:B, 7c4q:A, 7c4q:B, 7c4r:A, 7c4r:B
44	8buu:d	199	40	0.1313	0.0653	0.3250	1.4	8cdu:F, 8cdv:F, 8cec:F, 8ced:F, 8cee:F, 6ha1:d, 6ha8:d, 6htq:d, 3j9w:AD, 5njt:D, 7o5b:D, 7qgu:i, 7qh4:h, 8qpp:D, 7qv1:d, 7qv2:d, 7qv3:d, 8r55:D
45	1vfc:A	63	42	0.1515	0.2381	0.3571	1.8	3sjm:A, 3sjm:B, 1w0u:A, 1w0u:B
46	9gd1:W	849	24	0.1111	0.0130	0.4583	2.1
47	7tn2:W	895	24	0.1111	0.0123	0.4583	2.1	9gd2:W, 9gd3:W
48	6clv:C	257	30	0.1111	0.0428	0.3667	4.8	1ad4:A, 6clv:A, 6clv:B
49	6g0l:M	855	24	0.1111	0.0129	0.4583	5.8	7nkx:W, 5o9g:W
50	6ftx:W	878	24	0.1111	0.0125	0.4583	5.8	6g0l:W, 5j70:A, 5j70:B, 3mwy:W, 3ted:A
51	2eh6:A	375	25	0.1111	0.0293	0.4400	5.9	2eh6:B
52	5x71:A	796	42	0.1111	0.0138	0.2619	6.9	5x6y:A, 5x6y:C, 5x6z:C, 5x6z:A, 5x6z:D, 5x6z:B, 5x70:A, 5x70:B, 5x71:B
53	7r9g:A	386	14	0.0808	0.0207	0.5714	8.7	7r9f:A
54	4v58:G	2060	66	0.2020	0.0097	0.3030	8.9	4v58:H, 4v58:I, 4v58:J, 4v58:K, 4v58:L, 4v59:G, 4v59:H, 4v59:I, 4v59:J, 4v59:K, 4v59:L

[Back]