VVVLEAKNGNVTFDHKKHAGVKGECKACHETEAGGKIAGMGKDWAHKTCTGCHKEMGKGPTKCGECHK
The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3h4n:B | 69 | 68 | 1.0000 | 0.9855 | 1.0000 | 2.27e-43 | 3h4n:A |
2 | 3bxu:A | 71 | 69 | 0.6176 | 0.5915 | 0.6087 | 1.75e-21 | 3bxu:B |
3 | 3h34:A | 70 | 67 | 0.5441 | 0.5286 | 0.5522 | 3.23e-21 | |
4 | 4haj:A | 71 | 68 | 0.6029 | 0.5775 | 0.6029 | 1.83e-19 | 4hb6:A, 4hb8:A, 4hbf:A, 4hc3:A, 4hdl:A, 2ldo:A, 2lzz:A, 2mz9:A, 2n91:A, 1os6:A, 3sel:X, 3sj0:X, 3sj1:X, 3sj4:X |
5 | 3h33:A | 72 | 68 | 0.4853 | 0.4583 | 0.4853 | 1.33e-14 | |
6 | 1ehj:A | 68 | 68 | 0.5735 | 0.5735 | 0.5735 | 9.26e-11 | 1f22:A, 1hh5:A, 1kwj:A, 1l3o:A, 1lm2:A, 1new:A |
7 | 3cao:A | 103 | 48 | 0.3088 | 0.2039 | 0.4375 | 3.24e-07 | 3car:A |
8 | 1z1n:X | 516 | 82 | 0.4118 | 0.0543 | 0.3415 | 6.88e-04 | |
9 | 1z1n:X | 516 | 48 | 0.2647 | 0.0349 | 0.3750 | 0.23 | |
10 | 1z1n:X | 516 | 57 | 0.2500 | 0.0329 | 0.2982 | 0.45 | |
11 | 2cy3:A | 118 | 91 | 0.4118 | 0.2373 | 0.3077 | 0.008 | 1w7o:A |
12 | 1aqe:A | 110 | 91 | 0.3235 | 0.2000 | 0.2418 | 0.011 | 1czj:A |
13 | 1gws:A | 503 | 74 | 0.3088 | 0.0417 | 0.2838 | 0.056 | 2cvc:A, 1h29:A, 1h29:B, 1h29:C, 1h29:D |
14 | 1gws:A | 503 | 78 | 0.3382 | 0.0457 | 0.2949 | 0.40 | 2cvc:A, 1h29:A, 1h29:B, 1h29:C, 1h29:D |
15 | 1gws:A | 503 | 48 | 0.2353 | 0.0318 | 0.3333 | 0.62 | 2cvc:A, 1h29:A, 1h29:B, 1h29:C, 1h29:D |
16 | 2e84:A | 513 | 94 | 0.4412 | 0.0585 | 0.3191 | 0.086 | |
17 | 2e84:A | 513 | 47 | 0.2647 | 0.0351 | 0.3830 | 0.13 | |
18 | 2e84:A | 513 | 74 | 0.2941 | 0.0390 | 0.2703 | 0.38 | |
19 | 2e84:A | 513 | 51 | 0.2206 | 0.0292 | 0.2941 | 4.4 | |
20 | 6kls:C | 236 | 46 | 0.2353 | 0.0678 | 0.3478 | 0.12 | 6kls:F, 6klv:C, 6klv:F |
21 | 2bq4:B | 115 | 107 | 0.4265 | 0.2522 | 0.2710 | 0.19 | 2bq4:A |
22 | 6lod:A | 218 | 44 | 0.1618 | 0.0505 | 0.2500 | 0.44 | 6loe:A |
23 | 4nwv:A | 355 | 41 | 0.2500 | 0.0479 | 0.4146 | 1.2 | 4nwv:C, 4nwv:B, 4nww:A, 4nww:B, 4nww:C |
24 | 7mq8:LH | 746 | 53 | 0.2647 | 0.0241 | 0.3396 | 1.3 | 7mq9:LH, 7mqa:LH |
25 | 3eph:A | 402 | 23 | 0.1471 | 0.0249 | 0.4348 | 1.4 | 3eph:B, 3epj:A, 3epj:B, 3epk:A, 3epk:B, 3epl:A, 3epl:B |
26 | 1duw:A | 289 | 69 | 0.2647 | 0.0623 | 0.2609 | 1.6 | |
27 | 19hc:A | 292 | 71 | 0.2941 | 0.0685 | 0.2817 | 1.8 | 19hc:B, 1ofw:A, 1ofw:B, 1ofy:A, 1ofy:B |
28 | 19hc:A | 292 | 49 | 0.2647 | 0.0616 | 0.3673 | 7.1 | 19hc:B, 1ofw:A, 1ofw:B, 1ofy:A, 1ofy:B |
29 | 4qo5:A | 521 | 25 | 0.1471 | 0.0192 | 0.4000 | 2.0 | |
30 | 4qo5:A | 521 | 57 | 0.2206 | 0.0288 | 0.2632 | 9.9 | |
31 | 4lmh:D | 695 | 51 | 0.2647 | 0.0259 | 0.3529 | 2.7 | 4lmh:A, 4lmh:B, 4lmh:C |
32 | 6jzb:A | 251 | 21 | 0.1324 | 0.0359 | 0.4286 | 6.7 | |
33 | 6adq:C | 223 | 56 | 0.2500 | 0.0762 | 0.3036 | 7.9 | 6adq:O, 6hwh:M, 6hwh:K, 8ovc:O, 8ovc:C, 8ovd:O, 8ovd:C, 7rh5:O, 7rh5:I, 7rh6:O, 7rh6:I, 7rh7:O, 7rh7:I |