BioLiP

>protein
VVKFSYMWTINNFSFCREEMGEVIKSSTFSSKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGE
ETKAMESQRAYRFVQGKDWGFKKFIRRGFLLDEANGLLPDDKLTLFCEVSVV

The query sequence (length=132) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3hqi:A	294	134	0.9773	0.4388	0.9627	2.64e-86	7d3d:A, 7d3d:B, 6f8f:D, 6f8g:A, 6f8g:C, 6f8g:D, 6f8g:B, 3hqh:A, 3hqi:B, 3hql:A, 3hql:B, 3hqm:A, 3hqm:B, 3hsv:A, 3hsv:B, 3hu6:A, 3hu6:B, 6i41:A, 6i5p:A, 6i5p:C, 6i5p:E, 6i5p:G, 6i68:A, 6i68:C, 6i68:E, 6i68:G, 6i7a:A, 6i7a:C, 6i7a:E, 6i7a:G, 3ivb:A, 3ivq:A, 3ivq:B, 3ivv:A, 7klz:A, 7klz:B, 7kpk:A, 7lin:A, 7lio:A, 7lio:B, 4o1v:A
2	2f1w:A	144	125	0.2045	0.1875	0.2160	0.014	2foj:A, 2foo:A, 2fop:A, 4jjq:A, 4kg9:A, 3mqr:A, 3mqs:C, 2xxn:A, 4ysi:A, 1yy6:A
3	6jpk:A	409	55	0.1515	0.0489	0.3636	2.6	6jpk:B
4	7pu7:A	1070	65	0.1136	0.0140	0.2308	2.7	5lew:A
5	2r4h:C	98	60	0.1364	0.1837	0.3000	4.0
6	4rpu:A	988	31	0.0909	0.0121	0.3871	4.2	4l3t:A, 4l3t:B, 4nge:A, 4nge:D, 4rpu:B
7	6xov:A	966	31	0.0909	0.0124	0.3871	4.6
8	4wji:A	293	22	0.0682	0.0307	0.4091	6.0
9	8ip8:HB	205	103	0.1970	0.1268	0.2524	6.2	8ipa:HB, 8ipb:HB, 8jiv:CI
10	8iuf:C1	495	50	0.1212	0.0323	0.3200	7.8	8iuj:c1, 8iuj:C1

[Back]