VTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEV
FAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAE
YRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGS
The query sequence (length=193) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6m64:A | 203 | 193 | 1.0000 | 0.9507 | 1.0000 | 3.08e-147 | 7co1:A, 7co1:C, 7co1:E, 6m64:C, 6m64:E, 5xod:A, 6zvq:A |
2 | 1dd1:B | 249 | 219 | 0.4870 | 0.3775 | 0.4292 | 3.26e-53 | 1dd1:A, 1dd1:C |
3 | 5gom:A | 407 | 57 | 0.0829 | 0.0393 | 0.2807 | 1.2 | 5gnr:A, 5gof:A, 5gom:B, 5yew:A, 5yew:B, 5yew:C |
4 | 5goe:A | 384 | 57 | 0.0829 | 0.0417 | 0.2807 | 1.3 | 5gns:A, 5gnt:A |
5 | 2l8r:A | 150 | 76 | 0.1088 | 0.1400 | 0.2763 | 5.1 | 4j5r:A, 4j5r:B, 4j5s:A, 4j5s:B, 4j5s:C, 4j5s:D |