VTVPDALKDRIALKKTARQLNIVYFLGSDTEPVPDYERRLSELLLYLQQFYGKEMQRHGYGARSFGLDIKSPGRVNIIEY
KAKNPAAHYPYENGGGWKAAQELDEFFKAHPDRKKSQHTLIIMPTWNDEKNGPDNPGGVPFYGMGRNCFALDYPAFDIKH
LGQKTREGRLLTKWYGGMAAALGHGLNLPHNHQTASDGKKYGTALMGSGNYTFGTSPTFLTPASCALLDACEVFSVTPSQ
QFYEGKPEVEVGDVAISFKGDQILVSGNYKSPQTVKALNVYIQDPPYAVNQDYDAVSFSRRLGKKSGKFSMKIDKKELEG
LNNNEFRISLMFILANGLHMQKHFTFHWDALQDYRD
The query sequence (length=356) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6z2p:A | 356 | 356 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 6z2d:A, 6z2o:A, 6z2q:A |
2 | 8dek:B | 441 | 236 | 0.1770 | 0.1429 | 0.2669 | 6.68e-13 | 8dek:A, 8df2:A, 8df2:B, 8df2:C, 8df2:D |
3 | 2z71:C | 331 | 29 | 0.0337 | 0.0363 | 0.4138 | 4.0 | 2z71:A |
4 | 7cc7:A | 227 | 63 | 0.0478 | 0.0749 | 0.2698 | 5.8 | |
5 | 6sw9:Z | 197 | 65 | 0.0618 | 0.1117 | 0.3385 | 6.0 | 5jb3:Z, 5jbh:Z, 6skf:Ac, 6skg:Ac, 6swc:Z, 6swe:Z, 6th6:Ac, 4v4n:BC, 4v6u:AC, 7zag:Z, 7zah:Z, 7zai:Z, 7zhg:Z |