BioLiP

>protein
VTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEV
YGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAA
KLLALALIILLGFVQIGKGDVSNLDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLP
IVTLVYVLTNLAYFTTLSTEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSIL
SMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILAC
LFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLCQKLMQVVPQE

The query sequence (length=463) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7dsk:B	464	463	1.0000	0.9978	1.0000	0.0	7dsl:B, 7dsn:B, 7dsq:B, 8ida:B, 6irt:B, 8j8l:B, 8j8m:B, 8xpu:B
2	6jmq:A	403	431	0.8704	1.0000	0.9350	0.0
3	7cmh:B	458	456	0.5443	0.5502	0.5526	4.68e-173	7b00:A, 7cmi:B
4	7p9u:B	455	456	0.4795	0.4879	0.4868	2.02e-146	7epz:B
5	8wnt:B	463	463	0.4968	0.4968	0.4968	6.00e-137	8qey:A, 8wny:B
6	6li9:B	458	456	0.4536	0.4585	0.4605	8.41e-135	6li9:D
7	7nf6:B	455	459	0.4428	0.4505	0.4466	6.95e-128	7nf8:B
8	6f2w:A	433	436	0.2894	0.3095	0.3073	1.42e-51
9	6f34:A	458	424	0.2376	0.2402	0.2594	4.26e-22	5oqt:A
10	5j4n:A	437	347	0.1879	0.1991	0.2507	1.28e-09	5j4n:B, 3l1l:A, 3ob6:A, 3ob6:B

[Back]