VTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTEL
GLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIY
GAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGTDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHE
GYGTMTDGYTTYINASTCTVSFQPTNPPIIFDLPNP
The query sequence (length=276) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3rl5:A | 279 | 281 | 0.9891 | 0.9785 | 0.9715 | 0.0 | 3rl3:A, 3rl4:A |
2 | 8d0w:A | 298 | 50 | 0.0580 | 0.0537 | 0.3200 | 4.9 | 8d0q:A, 8d0r:A, 8d0s:A, 8d0u:A, 8d0x:A |
3 | 8c8b:A | 341 | 59 | 0.0616 | 0.0499 | 0.2881 | 6.3 | 5ahr:A, 4b87:A, 8c8d:A, 8c8s:A, 8cew:A, 8cf0:A, 8cg9:A, 5nzw:A, 5nzx:A, 5nzy:A, 5q1j:A, 5q1k:A, 5q1l:A, 5q1m:A, 5q1n:A, 5q1o:A, 5q1p:A, 5q1q:A, 5q1r:A, 5q1s:A, 5q1t:A, 5q1u:A, 5q1v:A, 5q1w:A, 5q1x:A, 5q1y:A, 5q1z:A, 5q20:A, 5q22:A, 5q23:A, 5q24:A, 5q25:A, 5q26:A, 5q27:A, 5q28:A, 5q29:A |
4 | 4ofq:A | 337 | 56 | 0.0616 | 0.0504 | 0.3036 | 6.7 | 4ofq:B |
5 | 4df9:C | 405 | 26 | 0.0399 | 0.0272 | 0.4231 | 8.3 | 4df9:A, 4df9:B, 4df9:D, 4df9:E, 4df9:F |