VSTGEFDHPPFQFRQRHTFNTTPLHDANRFGGRTAYLREIGPVNIKKQGRRFKKDPRTVQFNVDVWCAQQTLRKRWKQRD
WEVIEIPFRLVPREQQRVIPELYTDIPQMTDPARNDFSNIRNKVYDREELQGVLFPAAGAMLYPPLQRVDKQAMTLDKYL
The query sequence (length=160) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hiv:DV | 160 | 160 | 1.0000 | 1.0000 | 1.0000 | 6.02e-119 | 6hiw:DV, 6hiz:DV, 7pua:DV, 7pub:DV, 6sg9:DV, 6sgb:DV |
2 | 7aor:aw | 160 | 160 | 0.8250 | 0.8250 | 0.8250 | 4.74e-99 | |
3 | 7ane:aw | 139 | 139 | 0.6000 | 0.6906 | 0.6906 | 1.36e-69 | |
4 | 4fai:B | 305 | 38 | 0.0625 | 0.0328 | 0.2632 | 6.5 | 4fai:A, 4fbe:A, 4fbe:B |
5 | 7bvc:A | 1078 | 24 | 0.0813 | 0.0121 | 0.5417 | 7.3 | 7bvg:A |