VSTGEFDHPPFQFRQRHTFNTTPLHDANRFGGRTAYLREIGPKKQGRRFKKDPRTVQFNVDVWCAQQTLRKRWKQRDWEV
IEIPFRLVPREQQRVIPELYTDIPQMTDPARNDFSNIRNKVYDREELQGVLFPAAGAMLYPPLQRVDKQAMTLDKYL
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hiv:DV | 160 | 160 | 1.0000 | 0.9812 | 0.9812 | 1.52e-114 | 6hiw:DV, 6hiz:DV, 7pua:DV, 7pub:DV, 6sg9:DV, 6sgb:DV |
2 | 7aor:aw | 160 | 160 | 0.8217 | 0.8063 | 0.8063 | 1.15e-94 | |
3 | 7ane:aw | 139 | 139 | 0.6115 | 0.6906 | 0.6906 | 4.25e-67 | |
4 | 4fai:B | 305 | 38 | 0.0637 | 0.0328 | 0.2632 | 6.3 | 4fai:A, 4fbe:A, 4fbe:B |
5 | 7bvc:A | 1078 | 24 | 0.0828 | 0.0121 | 0.5417 | 6.9 | 7bvg:A |
6 | 8iau:H | 412 | 91 | 0.1592 | 0.0607 | 0.2747 | 7.8 | |
7 | 8iav:A | 451 | 91 | 0.1592 | 0.0554 | 0.2747 | 9.5 | 8iav:B |
8 | 8iav:C | 460 | 91 | 0.1592 | 0.0543 | 0.2747 | 9.9 | 8iav:D |