VSNLIVNGTAENGMDGWPDWGYPVSAVPEAAYGGTKGFKLSGGKQAGMGQKVALKPNTTYILGAWGKFTAKPGTYCDVIV
QYHLKDANNTYVQNILRFTETDWTYKQVVFTTPDAFGSDPEFVLWKDDASNADFYADNITLVE
The query sequence (length=143) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2zez:C | 143 | 143 | 1.0000 | 1.0000 | 1.0000 | 1.48e-104 | 2zez:A, 2zez:B, 2zez:D |
2 | 2zew:B | 147 | 141 | 0.6154 | 0.5986 | 0.6241 | 2.57e-57 | 3oea:A, 3oea:B, 3oeb:A, 2zew:A, 2zex:A, 2zex:B, 2zey:B, 2zey:A |
3 | 7kha:I | 385 | 97 | 0.1818 | 0.0675 | 0.2680 | 2.5 | |
4 | 4f1n:B | 853 | 102 | 0.1818 | 0.0305 | 0.2549 | 3.7 | |
5 | 4f1n:A | 904 | 103 | 0.1818 | 0.0288 | 0.2524 | 5.2 | 5the:A, 5the:C, 5the:E, 5the:G |
6 | 6yjs:BBB | 486 | 20 | 0.0559 | 0.0165 | 0.4000 | 9.0 | 6yjs:AAA |
7 | 6yjt:AAA | 513 | 20 | 0.0559 | 0.0156 | 0.4000 | 9.1 | 8ce3:A, 6yjt:BBB, 6yju:AAA, 6yju:BBB, 6yjv:AAA, 6yjv:BBB, 5zic:B |