BioLiP

>protein
VSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTL
LAANPFGQASASIMAAFM

The query sequence (length=98) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ytd:A	102	98	1.0000	0.9608	1.0000	6.58e-70	8yte:A, 8yte:C
2	2iep:A	187	82	0.2143	0.1123	0.2561	0.002	2iep:B
3	5lfu:A	487	98	0.2551	0.0513	0.2551	0.005	5lf5:A, 5lfr:A, 5lfr:B, 5lfv:B, 5lfv:A
4	5oyj:C	223	80	0.2041	0.0897	0.2500	0.006
5	6s9f:B	300	68	0.2245	0.0733	0.3235	0.053	6s9f:A
6	1djs:A	206	64	0.1939	0.0922	0.2969	0.071	3cu1:C, 3cu1:A, 1e0o:B
7	7ok5:A	582	68	0.1939	0.0326	0.2794	0.10	7ok5:B
8	7ok5:A	582	89	0.2449	0.0412	0.2697	3.5	7ok5:B
9	7ok5:A	582	68	0.1735	0.0292	0.2500	7.4	7ok5:B
10	2yd4:A	203	65	0.1939	0.0936	0.2923	0.18
11	2yd1:A	196	64	0.1735	0.0867	0.2656	0.23
12	5k6w:A	475	71	0.2143	0.0442	0.2958	0.24	5k6v:A, 5k6w:B
13	7ysh:D	213	64	0.1939	0.0892	0.2969	0.27	1fq9:C, 1fq9:D, 7ysh:E
14	2yd8:A	198	67	0.1735	0.0859	0.2537	0.30
15	7ysu:C	211	64	0.2041	0.0948	0.3125	1.5	7ysu:E
16	7ysw:C	213	62	0.1735	0.0798	0.2742	2.4	7ysw:E
17	2dv6:A	422	24	0.1122	0.0261	0.4583	3.4	2dv6:B, 2dv6:C, 2dv6:D, 2dv6:E, 2dv6:F
18	3doe:A	189	45	0.1633	0.0847	0.3556	4.0	3dof:A, 4gok:B, 4gok:A, 1ksg:A, 1ksh:A, 1ksj:A
19	2yxl:A	443	27	0.1224	0.0271	0.4444	5.0
20	7za1:E	251	60	0.1735	0.0677	0.2833	6.4	7za1:F, 7za1:H, 7za2:E, 7za2:G, 7za3:E, 7za3:G
21	2w2h:A	263	62	0.1837	0.0684	0.2903	6.9	5l1z:B, 2w2h:B
22	4tvm:A	380	67	0.1837	0.0474	0.2687	10.0

[Back]