BioLiP

>protein
VSAILVLTSSEASTLERVADLVTAHALYAAHDFCAQAQLAAAELPSRVVARLQEFAWGDMNEGHLLIKGLPQVRSLPPTP
TSNVHAVAATTPMSRYQALINECVGRMIAYEAEGHGHTFQDMVPSAMSAHSQTSLGSAVELELHTEQAFSPLRPDFVSLA
CLRGDPRALTYLFSARQLVATLTTQEIAMLREPMWTTTVDESFLAEGRTFLLGFERGPIPILSGADDDPFIVFDQDLMRG
ISAPAQELQQTVIRAYYAERVSHCLAPGEMLLIDNRRAVHGRSIFAPRFDGADRFLSRSFIVADGSRSRHARSSFGRVVS
ARFS

The query sequence (length=324) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6f2a:C	326	324	1.0000	0.9939	1.0000	0.0	6f2a:A, 6f2a:B, 6f2a:D, 6f2b:A, 6f2b:B, 6f2b:C, 6f2b:D, 6f6j:A, 6f6j:B, 6f6j:C, 6f6j:D
2	2og6:A	323	323	0.3241	0.3251	0.3251	7.07e-37	2og7:A
3	1ds1:A	323	303	0.2901	0.2910	0.3102	1.91e-28	1drt:A, 1dry:A, 1gvg:A
4	6vwq:A	325	299	0.2778	0.2769	0.3010	1.33e-27	6vwr:A
5	6daw:A	342	339	0.2716	0.2573	0.2596	2.41e-24	6daw:B
6	6alm:A	338	322	0.3056	0.2929	0.3075	6.21e-24	6aln:A, 6alo:A, 6alp:A, 6alq:A, 6alr:A, 6dax:A, 6daz:A, 6db2:A, 9eqf:A, 6mp9:A, 2wbo:A, 2wbp:A, 2wbq:A, 6y0n:A, 6y12:A
7	4ne0:A	337	332	0.3025	0.2908	0.2952	1.34e-23	4m25:A, 4m26:A, 4m26:C, 4m26:D, 4m27:A, 4m27:C, 4m27:D, 4m2c:B, 4m2c:C, 4m2c:D, 4m2e:B, 4m2e:C, 4m2e:D, 4m2f:A, 4m2f:C, 4m2f:D, 4m2g:A, 4m2g:C, 4m2g:D, 4m2i:A, 4ne0:C
8	4m25:B	317	319	0.2963	0.3028	0.3009	2.08e-23	4m25:C, 4m25:D, 4m26:B, 4m27:B, 4m2f:B, 4m2g:B, 4m2i:B, 4m2i:C, 4m2i:D, 4ne0:B, 4ne0:D
9	6mp8:A	308	301	0.2870	0.3019	0.3090	1.35e-22
10	7y5f:B	341	285	0.2747	0.2610	0.3123	3.93e-18	7vgn:A, 7y5f:A, 7y5i:A, 7y5i:B, 7y5p:A, 7y5p:B, 7yhe:A, 7yhe:B, 7yw9:A
11	6euo:C	354	297	0.2222	0.2034	0.2424	1.05e-11	6euo:A, 6euo:B, 6euo:D, 6eur:A, 6eur:C, 6eur:D, 6exf:A, 6exf:C, 6exf:D, 6exh:A, 6exh:B, 6exh:C, 6exh:D, 6f9p:A, 6f9p:C, 6f9p:D
12	6eur:B	328	301	0.2191	0.2165	0.2359	7.05e-10	6exf:B
13	7tcl:X	259	176	0.1173	0.1467	0.2159	0.002
14	6f9p:B	289	303	0.2160	0.2422	0.2310	0.005
15	3aer:D	421	84	0.0586	0.0451	0.2262	0.34	3aek:B, 3aek:D, 3aeq:B, 3aeq:D, 3aer:B, 3aes:B, 3aes:D, 3aet:B, 3aet:D, 3aeu:D
16	1nx4:C	250	32	0.0401	0.0520	0.4062	0.92	1nx4:A, 1nx8:A, 1nx8:C
17	2wjy:A	773	82	0.0586	0.0246	0.2317	1.1	2gjk:A, 2gk6:A, 2gk6:B, 2gk7:A, 8rxb:E, 8rxb:A, 8rxb:D, 8rxb:I, 8rxb:L, 8rxb:P, 2wjv:A, 2wjv:B, 2xzo:A
18	4oj8:B	271	32	0.0401	0.0480	0.4062	1.1	1nx4:B, 1nx8:B, 4oj8:A, 4oj8:C
19	6ujd:A	406	63	0.0556	0.0443	0.2857	2.0
20	6npb:B	378	77	0.0679	0.0582	0.2857	2.6	6npb:A, 6npc:A, 6npc:B, 6npd:A, 6npd:B
21	7wkv:A	219	39	0.0432	0.0639	0.3590	7.7	4nj4:A, 4nj4:B, 4nro:A, 4nrp:A, 4nrq:A, 4o7x:A, 4oct:A, 4oct:B, 7v4g:A, 7v4g:B, 7v4g:C, 7wkv:C, 7wkv:E, 7wl0:A, 7wl0:C, 7wl0:E, 7wl0:G, 7wl0:I

[Back]