VRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRID
GTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTD
The query sequence (length=160) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4hec:B | 163 | 160 | 1.0000 | 0.9816 | 1.0000 | 3.16e-116 | 4hec:A, 4hvj:A, 4hvj:B, 4oke:A, 4oke:B, 4okj:A, 4okj:B, 4okk:A, 4okk:B, 6s0m:B |
2 | 7aih:S | 150 | 68 | 0.1313 | 0.1400 | 0.3088 | 0.025 | 7am2:S, 7ane:S |
3 | 5d6j:A | 630 | 59 | 0.1125 | 0.0286 | 0.3051 | 0.15 | 5ey8:A, 5ey8:B, 5ey8:C, 5ey8:D, 5ey8:E, 5ey8:F, 5ey8:G, 5ey8:H, 5icr:A, 5icr:B, 5icr:C, 5icr:D |
4 | 6pxk:K | 429 | 105 | 0.1625 | 0.0606 | 0.2476 | 0.24 | 6pxk:I, 6pxk:A, 6pxk:C, 6pxk:E, 6pxl:B, 6pxl:F, 6pxl:G, 6pxl:K |
5 | 5fv7:A | 283 | 85 | 0.1562 | 0.0883 | 0.2941 | 0.28 | 5fv7:B |
6 | 7aoi:A3 | 150 | 68 | 0.1062 | 0.1133 | 0.2500 | 1.7 | 6hiv:A3, 6hix:A3, 6yxx:A3, 6yxy:A3 |
7 | 8pjg:D | 203 | 77 | 0.1250 | 0.0985 | 0.2597 | 1.8 | 1fyt:D, 1j8h:D, 6r0e:DDD |
8 | 6xu6:DA | 350 | 43 | 0.0813 | 0.0371 | 0.3023 | 2.3 | |
9 | 4ori:A | 355 | 32 | 0.0875 | 0.0394 | 0.4375 | 5.7 | 1uum:A, 1uum:B, 1uuo:A |
10 | 6cmz:A | 462 | 40 | 0.0750 | 0.0260 | 0.3000 | 7.2 | 6cmz:B, 6cmz:C, 6cmz:D |