VRTSSLGDTSAGNGANASGGNGTAVGGAASASGTDATALGQASNASGNHSTALGQASSASGSGSTAVGQGAGAPGDGASA
FGQGALASGTDSTALGAHSTAAAPNSAAIGANSVASAPNSVSFGSRGHERRLTNVAPGIDGTDAANMNQLWGVQSSVD
The query sequence (length=158) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 3s6l:D | 158 | 158 | 1.0000 | 1.0000 | 1.0000 | 1.71e-101 | 3s6l:A, 3s6l:B, 3s6l:C, 3s6l:E |
| 2 | 4usx:C | 214 | 99 | 0.2215 | 0.1636 | 0.3535 | 0.002 | 4usx:A, 4usx:B |
| 3 | 2xgf:A | 216 | 52 | 0.1392 | 0.1019 | 0.4231 | 4.3 | 2xgf:B, 2xgf:C |
| 4 | 7tin:B | 556 | 104 | 0.1709 | 0.0486 | 0.2596 | 5.0 | 7tin:A, 7tin:C, 7tin:D |
umich.edu