VRSKVYQIFLKNAPTREEVLKKVYEHAQQQQGLRKGWQVKAASWVKKIHVDRGDVKVGLRGRDGQFHVIDDLLPKYVVPD
LKNFELKPYVALS
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8a22:AF | 93 | 93 | 1.0000 | 1.0000 | 1.0000 | 2.89e-64 | 8apn:AF, 8apo:AF |
2 | 7pkt:E | 79 | 78 | 0.4839 | 0.5696 | 0.5769 | 1.46e-24 | |
3 | 6gaw:Be | 122 | 39 | 0.2151 | 0.1639 | 0.5128 | 1.16e-07 | 5aj4:Be, 6gb2:Be, 7nqh:Be, 7nql:Be, 7nsh:Be, 7nsi:Be, 7nsj:Be, 8oin:Bq, 8oiq:Bq, 6ydp:Be, 6ydw:Be |
4 | 6xyw:AG | 61 | 35 | 0.2043 | 0.3115 | 0.5429 | 6.75e-06 | |
5 | 7a5f:93 | 109 | 40 | 0.1828 | 0.1560 | 0.4250 | 4.50e-05 | 7a5g:93, 7a5i:93, 7a5k:93, 3j7y:9, 3j9m:9, 6nu2:9, 6nu3:9, 7oic:9 |
6 | 8any:9 | 124 | 55 | 0.2043 | 0.1532 | 0.3455 | 9.52e-05 | 7a5h:9, 7a5j:9, 6i9r:9, 8k2a:Lo, 8k2b:Lo, 7l08:9, 7l20:9, 7o9k:9, 7o9m:9, 7odr:9, 7ods:9, 7odt:9, 7of0:9, 7of2:9, 7of3:9, 7of4:9, 7of5:9, 7of6:9, 7of7:9, 7og4:9, 7oi6:9, 7oi7:9, 7oi8:9, 7oi9:9, 7oia:9, 7oib:9, 7oid:9, 7oie:9, 8oir:Bq, 8oit:Bq, 5ool:9, 5oom:9, 7pd3:9, 8pk0:9, 7po4:9, 7qh6:9, 7qh7:9, 7qi4:9, 7qi5:9, 7qi6:9, 8qsj:9, 8qu5:9, 6vlz:9, 6vmi:9, 8xt0:Lo, 8xt1:Lo, 8xt2:Lo, 8xt3:Lo, 6zm5:9, 6zm6:9, 6zs9:9, 6zsa:9, 6zsb:9, 6zsc:9, 6zsd:9, 6zse:9, 6zsg:9 |
7 | 5mrc:3 | 130 | 15 | 0.1290 | 0.0923 | 0.8000 | 0.048 | 3j6b:3, 5mre:3, 5mrf:3 |
8 | 8a22:Bd | 221 | 27 | 0.1290 | 0.0543 | 0.4444 | 0.35 | 8apn:Bd, 8apo:Bd |
9 | 6z1p:AI | 122 | 35 | 0.1505 | 0.1148 | 0.4000 | 0.97 | |
10 | 1gtt:A | 421 | 32 | 0.1075 | 0.0238 | 0.3125 | 1.1 | 1gtt:B, 1gtt:C, 1gtt:D, 1i7o:A, 1i7o:B, 1i7o:C, 1i7o:D |
11 | 6ywe:3 | 95 | 16 | 0.0968 | 0.0947 | 0.5625 | 2.3 | 6yws:3, 6ywv:3, 6ywx:3, 6ywy:3 |
12 | 6rxt:UG | 479 | 59 | 0.1720 | 0.0334 | 0.2712 | 2.6 | 5oql:F, 6rxu:UG, 6rxv:UG, 6rxx:UG, 6rxy:UG, 6rxz:UG |
13 | 3cg1:A | 293 | 70 | 0.1935 | 0.0614 | 0.2571 | 7.1 | 3cg1:B |
14 | 4kg0:A | 157 | 32 | 0.1183 | 0.0701 | 0.3438 | 8.0 | |
15 | 5v93:l | 123 | 45 | 0.1828 | 0.1382 | 0.3778 | 8.5 | 8crx:L, 8cwo:L, 6dzi:u, 6dzk:L, 8fr8:n, 7kgb:l, 7msc:l, 7msh:l, 7msm:l, 7msz:l, 7mt2:l, 7mt3:l, 7mt7:l, 5o5j:L, 5o61:BL, 7sfr:l, 8v9j:l, 8v9k:l, 8v9l:l, 8whx:m, 8wi7:m, 8wi9:m, 8wib:m, 8wid:m, 8wif:m, 5xyu:L, 5zeb:l, 5zep:l, 5zeu:l |