VRPRLIAELARRVRALREQLNRPRDSQLYAVDYETLTRPFSGRRLPVRAWADVRRESRLLQLLGRLPLFGLGRLVTRKSW
The query sequence (length=211) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8any:A0 |
215 |
211 |
1.0000 |
0.9814 |
1.0000 |
4.38e-156 |
8csp:0, 8csq:0, 8csr:0, 8css:0, 8cst:0, 8csu:0, 7l08:A0, 8oir:Aj, 8ois:Aj, 7p2e:0, 7pnx:0, 7pny:0, 7pnz:0, 7po0:0, 7po1:0, 7po2:0, 7po3:0, 7qi4:A0, 7qi5:A0, 7qi6:A0, 8qrk:0, 8qrl:0, 8qrm:0, 8qrn:0, 6rw4:0, 6rw5:0, 6vlz:A0, 6vmi:A0, 6zm5:A0, 6zm6:A0 |
2 |
7pnt:0 |
216 |
211 |
0.8910 |
0.8704 |
0.8910 |
4.08e-131 |
7a5f:a6, 7a5g:a6, 7a5i:a6, 7a5k:a6, 3j9m:A0, 8k2a:Sj, 6nu2:A0, 6nu3:A0, 7og4:A0, 7pnu:0, 7pnv:0, 7pnw:0, 8xt0:Sj, 8xt2:Sj, 6zs9:A0, 6zsa:A0, 6zsb:A0, 6zsc:A0, 6zsd:A0, 6zse:A0, 6zsg:A0 |
3 |
3jd5:j |
213 |
208 |
0.8294 |
0.8216 |
0.8413 |
2.37e-128 |
6neq:j, 6nf8:j |
4 |
5aj3:j |
213 |
209 |
0.8246 |
0.8169 |
0.8325 |
1.37e-116 |
5aj4:Aj, 6gaw:Aj, 6gaz:Aj, 7nqh:Aj, 7nql:Aj, 7nsi:Aj, 7nsj:Aj, 8oin:Aj, 8oip:Aj, 6ydp:Aj, 6ydw:Aj |
5 |
7aor:t |
226 |
136 |
0.1469 |
0.1372 |
0.2279 |
0.017 |
|
6 |
7pub:Cj |
227 |
113 |
0.1185 |
0.1101 |
0.2212 |
0.12 |
6hiv:Cj, 6hiw:Cj, 6hiy:Cj, 7pua:Cj, 6sga:Cj, 6sgb:Cj |
7 |
7pkq:z |
85 |
53 |
0.0853 |
0.2118 |
0.3396 |
0.14 |
|
8 |
6xyw:By |
76 |
84 |
0.0995 |
0.2763 |
0.2500 |
0.16 |
|
9 |
7ane:t |
226 |
109 |
0.1327 |
0.1239 |
0.2569 |
0.75 |
|
10 |
2gep:A |
472 |
61 |
0.0995 |
0.0445 |
0.3443 |
1.6 |
1aop:A, 2aop:A, 3aop:A, 4aop:A, 5aop:A, 6c3m:A, 6c3x:A, 6c3y:A, 6c3z:A, 4g39:A, 3geo:A, 4gep:A, 5gep:A, 6gep:A, 7gep:A, 8gep:A |
11 |
4g38:A |
449 |
61 |
0.0995 |
0.0468 |
0.3443 |
1.6 |
4htr:A |
12 |
1f76:A |
336 |
38 |
0.0758 |
0.0476 |
0.4211 |
2.0 |
1f76:B, 1f76:D, 1f76:E, 7t5k:A, 7t5k:B, 7t5y:A, 7t5y:B, 7t6c:A, 7t6c:B, 7t6h:A, 7t6h:B |
13 |
3qkt:A |
339 |
101 |
0.1090 |
0.0678 |
0.2277 |
3.5 |
4ncj:C, 4ncj:D, 3qkt:C |
14 |
8ro2:C |
908 |
76 |
0.0900 |
0.0209 |
0.2500 |
4.5 |
7aav:r, 7abf:r, 7abg:r, 7abi:r, 6ah0:C, 6ahd:C, 8c6j:C, 8ch6:b, 7dvq:C, 6ff4:B, 6ff7:B, 9fmd:C, 8h6e:5C, 8h6j:5C, 8h6k:5C, 8h6l:5C, 8i0p:C, 8i0r:C, 8i0s:C, 8i0t:C, 8i0u:C, 8i0v:C, 8i0w:C, 6icz:C, 6id0:C, 6id1:C, 8q7q:C, 8q7v:C, 8q7w:C, 8q7x:C, 8q91:C, 6qdv:C, 8qp8:C, 7qtt:b, 6qw6:5C, 6qx9:5C, 8rc0:C, 7w59:C, 7w5a:C, 7w5b:C, 5xjc:C, 8y6o:D, 5yzg:C, 5z56:C, 5z57:C, 5z58:C, 6zym:B |
15 |
3qxe:A |
201 |
58 |
0.0853 |
0.0896 |
0.3103 |
4.7 |
3qxe:C, 3qxe:E, 3qxe:G, 3qyg:A, 3qyg:C, 3qyg:E, 3qyg:G, 3qyh:A, 3qyh:C, 3qyh:E, 3qyh:G, 3qz5:A, 3qz5:C, 3qz5:E, 3qz5:G, 3qz9:A, 3qz9:C, 3qz9:E, 3qz9:G |
16 |
5veu:L |
448 |
59 |
0.0806 |
0.0379 |
0.2881 |
4.9 |
7lad:A, 8sg5:H, 7sv2:D, 5veu:E |
17 |
5veu:C |
469 |
59 |
0.0806 |
0.0362 |
0.2881 |
5.0 |
6mjm:A, 8sg5:A, 8sg5:B, 8sg5:C, 8sg5:D, 8sg5:E, 8sg5:F, 8sg5:G, 7sv2:A, 7sv2:B, 7sv2:C, 5veu:A, 5veu:B, 5veu:D, 5veu:F, 5veu:G, 5veu:H, 5veu:I, 5veu:J, 5veu:K |
18 |
4ob3:A |
204 |
58 |
0.0853 |
0.0882 |
0.3103 |
6.9 |
9d6k:A, 8i6n:A, 1ire:A, 4ob0:A, 4ob1:A, 4ob2:A, 1ugp:A, 1ugr:A, 1ugs:A, 3vyh:A, 7w8l:A, 7w8m:A |