VRLPGLAAMRQGTRLFTPEQGEDLREALRRRRGSFQTTCEVTSETTFAAARRLREKASALAALNFASAKNPGGGFAQAQE
EDLCRGSGLYFSLTSPQAEPYYAVNRQSHSALYTDHLIYSPQVPIFRDDAGQLLPAPVPVNIITAPAPNAGAVAQSRPEQ
LPQVLPTLRERARRVLGVAAWMEQTHLVLGAWGCGVFRNDPAGVARTFRELLEGEAQGAFEHVTFAVLDNHPQHPTLGAF
RRELESLCLP
The query sequence (length=250) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5zdb:A | 253 | 253 | 1.0000 | 0.9881 | 0.9881 | 0.0 | 5zdb:B, 5zdc:C, 5zdc:F, 5zdc:H, 5zdc:J, 5zdc:L, 5zdc:D, 5zdd:A, 5zde:C, 5zdf:A, 5zdg:C |
2 | 3sig:A | 265 | 241 | 0.4840 | 0.4566 | 0.5021 | 3.24e-58 | 3sii:A |
3 | 3pgr:A | 376 | 97 | 0.0960 | 0.0638 | 0.2474 | 0.35 | 2r8a:A, 2r8a:B |
4 | 3pgs:A | 427 | 97 | 0.0960 | 0.0562 | 0.2474 | 0.38 | 3pf1:A, 3pf1:B, 3pgs:B, 3pgu:A, 1t16:A, 1t16:B |
5 | 8xku:A | 730 | 42 | 0.0640 | 0.0219 | 0.3810 | 1.9 | 8xkv:A |
6 | 2gbw:A | 449 | 51 | 0.0680 | 0.0379 | 0.3333 | 7.3 | 2ckf:A, 2gbw:C, 2gbw:E, 2gbx:A, 2gbx:C, 2gbx:E |
7 | 1o4s:B | 384 | 46 | 0.0760 | 0.0495 | 0.4130 | 8.2 | 1o4s:A |
8 | 7ylq:A | 480 | 34 | 0.0560 | 0.0292 | 0.4118 | 8.5 | 7ylq:B |