BioLiP

>protein
VRLKSRYILFEIIFPPTDTNVEESVSKADILLSHHRASPADVSIKSILQEIRRSLSLNLGDYGSAKCNSLLQLKYFSNKT
STGIIRCHREDCDLVIMALMLMSKIGDVDGLIVNPVKVSGTIKKIEQFAMRRNSKILNIIKCSQS

The query sequence (length=145) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6w6v:E	169	145	1.0000	0.8580	1.0000	6.15e-104	6agb:E, 6ah3:E, 7c79:E, 7c7a:E
2	6ahr:E	147	143	0.2483	0.2449	0.2517	1.32e-05	6ahu:E
3	6k0a:A	126	124	0.2276	0.2619	0.2661	1.31e-04	6k0a:B, 6k0b:A, 6k0b:B
4	7tuv:A	672	66	0.1379	0.0298	0.3030	0.60
5	2ogj:A	379	75	0.1448	0.0554	0.2800	2.1	2ogj:B, 2ogj:C, 2ogj:D, 2ogj:E, 2ogj:F
6	3jb9:A	1964	32	0.0897	0.0066	0.4062	2.1
7	8q7x:A	1914	29	0.0828	0.0063	0.4138	7.1
8	8qp8:A	1918	29	0.0828	0.0063	0.4138	7.1
9	5z57:A	1978	29	0.0828	0.0061	0.4138	7.1
10	8i0p:A	2149	29	0.0828	0.0056	0.4138	7.1	8q7q:A, 8q7v:A, 8q7w:A
11	7abg:A	2174	29	0.0828	0.0055	0.4138	7.1	7abi:A, 8q91:A, 8rc0:A
12	8y6o:C	2227	29	0.0828	0.0054	0.4138	7.1	8h6e:5B, 8h6j:5B, 8qp9:A, 6qw6:5A, 6qx9:5A, 8qxd:A, 8r08:A
13	5z56:A	2232	29	0.0828	0.0054	0.4138	7.1	7aav:A, 7abf:A, 8ch6:a, 7dvq:A, 8i0s:A, 5z58:A
14	8h6k:5B	2253	29	0.0828	0.0053	0.4138	7.2	8h6l:5B, 8i0u:A, 8i0v:A, 8q7n:A, 8qo9:A, 8qpe:A, 7qtt:a, 8qzs:A
15	8c6j:A	2261	29	0.0828	0.0053	0.4138	7.2	6ah0:A, 6ahd:A, 8bc8:J, 6ff4:A, 6ff7:A, 9fmd:A, 8i0r:A, 8i0t:A, 8i0w:A, 6icz:A, 6id0:A, 6id1:A, 4jk9:A, 4jk9:B, 4jka:A, 4jka:B, 5mqf:A, 5o9z:A, 6qdv:A, 8qoz:A, 8qpa:A, 8qpb:A, 8qpk:A, 8r09:A, 8r0a:A, 8r0b:A, 8rm5:A, 8ro2:A, 7w59:A, 7w5a:A, 7w5b:A, 5xjc:A, 5yzg:A, 6zym:A
16	8ro0:A	2231	29	0.0828	0.0054	0.4138	7.8	8ro1:A
17	7oik:A	4426	52	0.0966	0.0032	0.2692	9.0	7oim:A, 6tax:A, 6tay:A

[Back]