VRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCRKEFYQLVWSAL
PFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQKSVTRSCLL
The query sequence (length=147) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ahr:E | 147 | 147 | 1.0000 | 1.0000 | 1.0000 | 1.49e-107 | 6ahu:E |
2 | 6w6v:E | 169 | 143 | 0.2449 | 0.2130 | 0.2517 | 1.20e-05 | 6agb:E, 6ah3:E, 7c79:E, 7c7a:E |
3 | 6c1q:B | 374 | 27 | 0.0952 | 0.0374 | 0.5185 | 0.81 | 6c1r:B, 5o9h:A, 5o9h:B, 7y65:D, 7y66:D, 7y67:D |
4 | 7mk3:B | 365 | 67 | 0.1293 | 0.0521 | 0.2836 | 3.8 | 7mk2:A, 7mk2:B, 7mk3:A, 7tac:A, 7tac:B, 7tad:A, 7tad:B |
5 | 8kgg:R | 290 | 29 | 0.0816 | 0.0414 | 0.4138 | 4.1 | |
6 | 8d8j:d | 660 | 70 | 0.1224 | 0.0273 | 0.2571 | 5.4 | 8d8k:d |
7 | 7xv3:R | 289 | 48 | 0.1088 | 0.0554 | 0.3333 | 6.8 | 8izb:R, 8kh5:A |
8 | 8hnk:R | 297 | 32 | 0.0816 | 0.0404 | 0.3750 | 7.4 | 8hnl:R, 8hnm:R, 8hnn:R, 8k2w:R, 8k2x:R |
9 | 3fim:B | 565 | 34 | 0.0816 | 0.0212 | 0.3529 | 9.9 | 5oc1:A |