VQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKG
IPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKG
The query sequence (length=127) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4rha:A | 131 | 127 | 0.9843 | 0.9542 | 0.9843 | 2.06e-88 | 4rha:B, 5ves:B |
2 | 6top:A | 154 | 94 | 0.3150 | 0.2597 | 0.4255 | 1.66e-20 | 6top:B, 6top:C, 6top:D |
3 | 5u1h:C | 123 | 123 | 0.3622 | 0.3740 | 0.3740 | 1.20e-15 | 5u1h:A, 5u1h:B, 5u1h:D |
4 | 7rjj:A | 120 | 120 | 0.3465 | 0.3667 | 0.3667 | 1.39e-11 | 7rjj:B |
5 | 7muc:BL | 173 | 122 | 0.2677 | 0.1965 | 0.2787 | 5.50e-11 | 7muc:CL, 7muc:EL, 7muc:FL, 7muc:GL, 7muc:HL, 7muc:IL, 7muc:JL, 7muc:KL, 7muc:LL, 7muc:AL, 7mud:BL, 7mud:CL, 7mud:DL, 7mud:EL, 7mud:FL, 7mud:GL, 7mud:HL, 7mud:IL, 7mud:JL, 7mud:KL, 7mud:LL, 7mud:ML, 7mud:AL, 7muq:HL, 7muq:IL, 7muq:JL, 7muq:KL, 7muq:LL, 7muq:ML, 7muq:AL, 7muq:BL, 7muq:CL, 7muq:DL, 7muq:EL, 7muq:FL, 7muq:GL, 7mus:HL, 7mus:IL, 7mus:JL, 7mus:KL, 7mus:LL, 7mus:ML, 7mus:AL, 7mus:BL, 7mus:CL, 7mus:DL, 7mus:EL, 7mus:FL, 7mus:GL, 7muv:FL, 7muv:GL, 7muv:HL, 7muv:IL, 7muv:JL, 7muv:KL, 7muv:LL, 7muv:ML, 7muv:AL, 7muv:BL, 7muv:CL, 7muv:DL, 7muv:EL, 7muw:FL, 7muw:GL, 7muw:HL, 7muw:IL, 7muw:JL, 7muw:KL, 7muw:LL, 7muw:ML, 7muw:AL, 7muw:BL, 7muw:CL, 7muw:DL, 7muw:EL, 7muy:FL, 7muy:GL, 7muy:HL, 7muy:IL, 7muy:JL, 7muy:KL, 7muy:LL, 7muy:ML, 7muy:AL, 7muy:BL, 7muy:CL, 7muy:DL, 7muy:EL |
6 | 6u83:A | 154 | 97 | 0.2835 | 0.2338 | 0.3711 | 5.76e-11 | |
7 | 4g4v:A | 111 | 114 | 0.2835 | 0.3243 | 0.3158 | 1.23e-09 | 4g4w:A, 4g4x:A |
8 | 4pwt:C | 123 | 98 | 0.2598 | 0.2683 | 0.3367 | 3.07e-08 | |
9 | 5wtl:C | 260 | 114 | 0.2835 | 0.1385 | 0.3158 | 8.54e-08 | 5wtl:A, 5wtl:B, 5wtl:D |
10 | 2aiz:P | 134 | 86 | 0.2441 | 0.2313 | 0.3605 | 2.27e-07 | |
11 | 5lkw:A | 119 | 93 | 0.2205 | 0.2353 | 0.3011 | 2.34e-05 | 5lkw:B, 5n2c:A, 5n2c:B, 5n2c:C |
12 | 3oon:A | 113 | 52 | 0.1339 | 0.1504 | 0.3269 | 0.004 | |
13 | 7muq:GK | 151 | 82 | 0.1654 | 0.1391 | 0.2561 | 0.005 | 7muq:LK, 7muq:MK, 7muq:BK, 7muq:DK, 7mus:GK, 7mus:HK, 7mus:IK, 7mus:JK, 7mus:LK, 7mus:AK, 7muv:EK, 7muv:FK, 7muv:HK, 7muv:IK, 7muv:MK, 7muv:BK, 7muw:EK, 7muw:GK, 7muw:JK, 7muw:KK, 7muw:LK, 7muw:MK, 7muw:BK, 7muy:FK, 7muy:GK, 7muy:IK, 7muy:AK, 7muy:BK |
14 | 7z0s:G | 250 | 47 | 0.1339 | 0.0680 | 0.3617 | 1.7 | 7z0t:G |
15 | 3ulk:A | 489 | 75 | 0.1496 | 0.0389 | 0.2533 | 1.8 | 3ulk:B |
16 | 3dm5:A | 416 | 89 | 0.2047 | 0.0625 | 0.2921 | 2.2 | 3dm5:B |
17 | 7qep:N5 | 93 | 46 | 0.1024 | 0.1398 | 0.2826 | 4.6 | |
18 | 1zt2:A | 327 | 28 | 0.0787 | 0.0306 | 0.3571 | 6.0 | 5of3:A, 5of3:D, 5ofn:A, 1zt2:C |
19 | 1bg1:A | 559 | 38 | 0.1181 | 0.0268 | 0.3947 | 6.5 | 4e68:A, 6njs:A, 6nuq:A, 6qhd:A |
20 | 7xld:B | 125 | 41 | 0.1102 | 0.1120 | 0.3415 | 6.7 | 7xli:B |
21 | 8b6d:A | 291 | 54 | 0.1339 | 0.0584 | 0.3148 | 7.7 | 8b68:A, 8b6d:B |
22 | 6mqs:A | 224 | 56 | 0.1181 | 0.0670 | 0.2679 | 7.7 | 6mqs:C, 6p60:A, 6p60:C, 6p60:J, 6p60:G |
23 | 6ifc:A | 132 | 84 | 0.1575 | 0.1515 | 0.2381 | 8.1 | 6ifc:C, 6ifc:E, 6ifc:G |
24 | 1b9h:A | 384 | 21 | 0.0709 | 0.0234 | 0.4286 | 8.1 | 1b9i:A |
25 | 8kcx:A | 571 | 23 | 0.0709 | 0.0158 | 0.3913 | 8.4 | 8kcx:C |
26 | 8woq:A | 647 | 23 | 0.0709 | 0.0139 | 0.3913 | 8.5 | 8j6m:B, 8j6m:A, 8jul:A, 8jul:B, 8kcw:A, 8kcw:C, 8woq:B, 8wor:A, 8wor:B, 8wos:A, 8wos:B, 8wot:A, 8wot:B |
27 | 8jun:A | 678 | 23 | 0.0709 | 0.0133 | 0.3913 | 8.6 | 8jun:B |
28 | 5d2l:F | 238 | 64 | 0.1496 | 0.0798 | 0.2969 | 8.7 | 5d2l:J, 5d2l:P |