BioLiP

>protein
VPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWST
EINQLIAGVNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKL
HFVWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSFYGMADKVDVKTWKSTEHN
MGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPKFWKVLVPQIPRIFHAGRPSTQSAQIESLLNNNKQYMFP
ETLTISEVVAISPPRKNGGWGDIRDHELCKSYRR

The query sequence (length=354) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5vcm:B	358	365	0.9746	0.9637	0.9452	0.0	5vcm:A, 5vcs:A
2	5vcs:B	323	350	0.8983	0.9845	0.9086	0.0
3	8iu7:B	323	50	0.0452	0.0495	0.3200	1.1	8iu7:A, 8iu7:C, 8iu7:D
4	5jwg:A	703	66	0.0480	0.0242	0.2576	3.3	5jwg:B, 5jwi:A, 5jwi:B, 5jy0:A
5	2r8u:A	131	33	0.0339	0.0916	0.3636	4.4
6	6grh:C	266	64	0.0565	0.0752	0.3125	5.1	6gos:C, 6grg:C, 6gri:C
7	5ggi:B	551	58	0.0480	0.0309	0.2931	6.1	5ggi:A, 5ggj:A, 5ggj:B, 5ggk:A, 5ggk:B, 5ggl:A, 5ggl:B, 5ggn:A, 5ggn:B, 5ggo:A, 5ggo:B, 5ggp:A, 5ggp:B, 5xfc:A, 5xfc:B
8	5guw:B	449	52	0.0395	0.0312	0.2692	7.8	5guw:D, 5gux:B, 3o0r:B, 3wfb:B, 3wfc:B, 3wfd:B, 3wfe:B
9	5llw:B	673	32	0.0311	0.0163	0.3438	8.6	5llw:A, 5llx:A, 5llx:B, 5lly:D, 5lly:A, 5lly:C, 5lly:B, 6saw:A, 6saw:B, 6saw:C, 6saw:D, 6saw:E, 6saw:F, 6saw:G, 6saw:H, 6sax:B, 6sax:A
10	6et7:A	646	32	0.0311	0.0170	0.3438	9.0	6et7:B

[Back]