VPPHVPFELSGAELRDAIVQYATNPIYHDNLDWLNHDNPYRRQLRPQVLPHLDYDKVPGRENILNYASLAVQRLLTSVYE
ADLVFFPKSGLKGKEEDFRAFYSPANRALGERIRPALERYAFGFLDDEVGTWTAQSLDAYLDSLEQSPVEKAILGSADRE
RAARMWLVQFAPDFLSEASPMMRNVLGYYGPAQSEWFKVVIDEYGYGVHDTKHSTLFERTLESVGLESDLHRYWQYYLNS
SLLLNNYFHYLGKNHELFFRYVGALYYTESSLVDFCRRADHLLREVFGDTVDTTYFTEHIHIMAREKIIKPLVEAHGDGI
IPEIVRGIEEYRVLLEIGDFDFSEQIAWMDAQPELKKLHDPVFEGLKQGKVDAPVAHLVEPRGELSNTHCHDGDELCHIV
SGTMRFESGLGSSLTLQAGEGVVIKRNRLHGANIESDECVYEIHSVGDYRKCL
The query sequence (length=453) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6vzy:A | 464 | 459 | 1.0000 | 0.9763 | 0.9869 | 0.0 | 8e8w:A, 8e8w:B, 6m9r:A, 6m9r:B, 6m9s:A, 6m9s:B, 6m9s:C, 6m9s:D, 6vzy:B |
2 | 7zyb:A | 112 | 50 | 0.0331 | 0.1339 | 0.3000 | 0.24 | 7zyc:A |
3 | 4ac8:A | 311 | 28 | 0.0243 | 0.0354 | 0.3929 | 1.6 | 4ac8:B, 4ac8:C, 4ac8:D, 3ee4:A |
4 | 7d11:A | 79 | 26 | 0.0265 | 0.1519 | 0.4615 | 2.5 | 6j4e:B |
5 | 7dnp:A | 174 | 65 | 0.0353 | 0.0920 | 0.2462 | 2.8 | |
6 | 3gri:B | 423 | 57 | 0.0486 | 0.0520 | 0.3860 | 3.5 | 3gri:A |
7 | 4pne:B | 272 | 50 | 0.0353 | 0.0588 | 0.3200 | 3.6 | 4pne:A |
8 | 5fpx:B | 107 | 52 | 0.0331 | 0.1402 | 0.2885 | 5.0 | 5fpx:A |
9 | 2c1c:A | 312 | 113 | 0.0640 | 0.0929 | 0.2566 | 5.7 | 2c1c:B |
10 | 5li0:E | 218 | 52 | 0.0309 | 0.0642 | 0.2692 | 7.8 | 7asm:D, 7asn:D, 7aso:e, 7asp:D, 6ddd:L, 6ddg:L, 6fxc:AD, 6fxc:BD, 5hkv:B, 5hl7:B, 6hma:D, 5nd8:E, 5nd9:E, 5ngm:AD, 7nhl:H, 7nhm:H, 5nrg:B, 8p2f:H, 8p2g:H, 8p2h:H, 7p48:D, 6s0x:D, 6s0z:D, 6s12:D, 6s13:D, 6sj6:E, 5t7v:LC, 5tcu:LC, 7ttu:L, 7ttw:L, 4wce:B, 4wf9:B, 4wfa:B, 4wfb:B, 6wqn:L, 6wqq:L, 6wrs:L, 6wru:L, 8y36:D, 8y37:D, 8y38:D, 8y39:D, 6yef:E |
11 | 2d40:A | 289 | 89 | 0.0530 | 0.0830 | 0.2697 | 9.9 | 2d40:B, 2d40:C, 2d40:D |
12 | 6kqs:A | 620 | 30 | 0.0287 | 0.0210 | 0.4333 | 10.0 | 6kqt:A |