VPPHVPFELSGAELRDAIVQYATNPIYHDNLDWLNHDNPYRRQLRPQVLPHLDYDKVPGRENILNYASLAVQRLLTSVYE
ADLVFFPKSGLKGKEEDFRAFYSPANRALGERIRPALERYAFGFLDDEVGTWTAQSLDAYLDSLEQSPVEKAILGSADRE
RAARMWLVQFAPDFLSEASPMMRNVLGYYGPAQSEWFKVVIDEYGGVHDTKHSTLFERTLESVGLESDLHRYWQYYLNSS
LLLNNYFHYLGKNHELFFRYVGALYYTESSLVDFCRRADHLLREVFGDTVDTTYFTEHIHGRMAREKIIKPLVEAHGDGI
IPEIVRGIEEYRVLLEIGDFDFSEQIAWMDAQPELKKLHDPVFEGLKQGKVAPVAHLVEPRGELSNTHCHDGDELCHIVS
GTMRFESGLGSSLTLQAGEGVVIKRNRLHGANIESDECVYEIHSVGDYRKCL
The query sequence (length=452) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6vzy:A | 464 | 459 | 1.0000 | 0.9741 | 0.9847 | 0.0 | 8e8w:A, 8e8w:B, 6m9r:A, 6m9r:B, 6m9s:A, 6m9s:B, 6m9s:C, 6m9s:D, 6vzy:B |
2 | 7zyb:A | 112 | 50 | 0.0332 | 0.1339 | 0.3000 | 0.24 | 7zyc:A |
3 | 7dbe:B | 332 | 58 | 0.0442 | 0.0602 | 0.3448 | 1.9 | 7dbe:A, 7dbe:C, 7dbe:D, 7wud:B, 7wud:A, 7wud:C, 7wud:D |
4 | 7d11:A | 79 | 26 | 0.0265 | 0.1519 | 0.4615 | 2.5 | 6j4e:B |
5 | 4pne:B | 272 | 49 | 0.0332 | 0.0551 | 0.3061 | 2.7 | 4pne:A |
6 | 7dnp:A | 174 | 65 | 0.0354 | 0.0920 | 0.2462 | 2.9 | |
7 | 3gri:B | 423 | 58 | 0.0487 | 0.0520 | 0.3793 | 3.5 | 3gri:A |
8 | 4ac8:A | 311 | 24 | 0.0243 | 0.0354 | 0.4583 | 3.8 | 4ac8:B, 4ac8:C, 4ac8:D, 3ee4:A |
9 | 1rcw:B | 214 | 67 | 0.0531 | 0.1121 | 0.3582 | 4.0 | 1rcw:A, 1rcw:C |
10 | 3es7:A | 387 | 163 | 0.0863 | 0.1008 | 0.2393 | 4.5 | 3es7:B, 3es8:A, 3es8:B, 3es8:C, 3es8:D, 3es8:E, 3es8:F, 3es8:G, 3es8:H, 3fyy:A, 3fyy:B, 3hpf:A, 3hpf:B, 2oqy:A, 2oqy:B, 2oqy:C, 2oqy:D, 2oqy:E, 2oqy:F, 2oqy:G, 2oqy:H |
11 | 5fpx:B | 107 | 52 | 0.0332 | 0.1402 | 0.2885 | 4.9 | 5fpx:A |
12 | 2wyw:A | 259 | 54 | 0.0442 | 0.0772 | 0.3704 | 5.5 | 2wyv:B, 2wyv:D, 2wyw:B, 2wyw:C, 2wyw:D, 2yw9:D, 2yw9:H |
13 | 2c1c:A | 312 | 113 | 0.0642 | 0.0929 | 0.2566 | 6.0 | 2c1c:B |
14 | 7s2z:B | 173 | 72 | 0.0398 | 0.1040 | 0.2500 | 8.7 | 6o0w:A, 7s2z:A, 7s2z:C, 7s2z:D |
15 | 6kqs:A | 620 | 30 | 0.0288 | 0.0210 | 0.4333 | 9.6 | 6kqt:A |