BioLiP

>protein
VPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQS
VMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI

The query sequence (length=115) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3d73:A	119	115	0.9913	0.9580	0.9913	4.21e-82	3bfa:A, 3bfb:A, 3bjh:A, 3cyz:A, 3cyz:B, 3cz0:A, 3cz0:B, 3cz1:A, 3cz1:B, 3d73:B, 3d74:A, 3d74:B, 3d75:A, 3d76:A, 3d77:A, 3d78:A, 3d78:B
2	3k1e:B	116	114	0.2957	0.2931	0.2982	3.59e-16
3	5el2:A	125	114	0.2609	0.2400	0.2632	7.78e-13	5el2:B, 4fqt:A, 4fqt:B, 3n7h:A, 3n7h:B, 3ogn:A, 3ogn:B
4	3r1v:A	124	89	0.1913	0.1774	0.2472	1.24e-07	3r1v:B
5	8bxv:AAA	123	108	0.2000	0.1870	0.2130	8.97e-05	8bxw:AAA
6	8c6e:A	124	105	0.1913	0.1774	0.2095	0.004	3q8i:A
7	3r72:A	122	115	0.1913	0.1803	0.1913	0.006
8	3rzs:A	119	46	0.1217	0.1176	0.3043	0.12	3s0b:A, 3s0d:A, 3s0e:A
9	1ooh:A	126	104	0.1913	0.1746	0.2115	0.13	3b6x:A, 3b6x:B, 3b7a:A, 3b86:A, 3b86:B, 2gte:A, 2gte:B, 1oog:A, 1oog:B, 1ooh:B
10	2wc5:A	141	100	0.2261	0.1844	0.2600	0.50	2wc6:A, 2wch:A, 2wcj:A, 2wcl:A, 2wcm:A
11	8izl:A	2067	49	0.1391	0.0077	0.3265	0.68	8izm:A, 8x01:A, 8yxm:A, 8yxp:A
12	6nbn:A	123	97	0.1652	0.1545	0.1959	0.84	6ogh:A, 6oii:A, 6oii:B, 6opb:E, 6opb:F, 6opb:I
13	6v4c:A	294	53	0.1565	0.0612	0.3396	0.85
14	5gpc:A	190	69	0.1304	0.0789	0.2174	1.3	5gpc:B, 5gpc:C, 5gpc:D
15	3oth:A	395	26	0.1043	0.0304	0.4615	2.8	3otg:A, 3oth:B

[Back]