BioLiP

>protein
VPANAVTESDPAAVALKYHRDAASSERVAAARPGLPPEEQHCENCQFMNPDSAAADWKGCQLFPGKLINLSGWCASWTLR

The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3hip:A	82	80	1.0000	0.9756	1.0000	4.82e-56	3hip:B, 3hip:C
2	1js2:A	89	81	0.7375	0.6629	0.7284	8.36e-40	3a38:A, 3a39:A, 6aiq:A, 6air:A, 2ams:A, 1b0y:A, 7c52:b, 1cku:A, 1cku:B, 5d8v:A, 1eyt:A, 2fla:A, 1hip:A, 1hrq:A, 1hrr:A, 1iua:A, 1js2:B, 1js2:C, 1js2:D, 1neh:A, 1noe:A, 7vos:A, 5wqq:A, 5wqr:A
3	1hpi:A	71	75	0.4000	0.4507	0.4267	1.87e-14
4	1hlq:A	75	75	0.2500	0.2667	0.2667	5.26e-04	1hlq:B, 1hlq:C
5	3h31:A	74	45	0.2000	0.2162	0.3556	0.004
6	4eb5:C	138	30	0.1875	0.1087	0.5000	0.41	4eb5:D, 4eb7:C
7	6rft:A	406	52	0.2125	0.0419	0.3269	0.46	6rft:B, 6rft:C, 6rft:D, 6rft:E, 6rft:F, 6rfx:D, 6rfx:A, 6rfx:B, 6rfx:C, 6rfx:E
8	6z1p:Av	206	33	0.1625	0.0631	0.3939	2.7
9	3w5m:A	1030	50	0.1625	0.0126	0.2600	2.9	3w5n:A
10	8oz0:J	687	65	0.2250	0.0262	0.2769	3.5	8pj2:y, 8pj3:y, 7qp7:y
11	8pj1:y	731	65	0.2250	0.0246	0.2769	3.5	6fec:2, 8pj4:y, 8pj5:y, 8pj6:y, 8ppl:Iy, 7qp6:y, 8rg0:y, 6w2s:2, 6w2t:2, 6ybw:y, 6zmw:y
12	6blk:C	158	37	0.1625	0.0823	0.3514	4.6	6blk:D, 6blk:A, 6blk:B
13	3pps:A	564	33	0.1375	0.0195	0.3333	4.8	3pps:B, 3pps:C, 3pps:D
14	3dha:A	254	13	0.1125	0.0354	0.6923	5.0	2a7m:A, 2br6:A, 2btn:A, 3dhb:A, 3dhc:A, 5eh9:A, 5eht:A, 4j5f:A, 4j5h:A, 7l5f:A
15	5e1r:C	358	30	0.1375	0.0307	0.3667	9.9	5e1r:A, 5e1r:B, 5e1r:D, 5e1r:E, 5e1r:F

[Back]