BioLiP

>protein
VPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHDTEFQHPCFLR
GQEQLLENIKRKV

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7dcj:B	110	102	1.0000	0.8455	0.9118	1.10e-64	5d5u:B, 5d5v:B, 5d5v:D, 7dcj:A, 7dcs:A, 7dcs:B, 7dcs:C, 7dcs:D, 7dcs:E, 7dcs:F, 7dct:A, 7dct:B, 7dct:C, 7dct:D, 7dct:E, 7dct:F, 5hdn:A, 5hdn:C
2	7dcu:A	101	94	0.7204	0.6634	0.7128	8.61e-44	7dci:A, 7dcu:C
3	5d8k:B	106	105	0.7204	0.6321	0.6381	9.27e-43	5d8l:B, 5d8l:D, 5d8l:F, 5d8l:H, 7dcu:B
4	5d5x:B	99	97	0.4624	0.4343	0.4433	2.95e-24	5d5w:B, 5d5x:E
5	1fyk:A	88	66	0.4194	0.4432	0.5909	1.58e-23	3hts:B
6	8pqw:A	2892	38	0.1505	0.0048	0.3684	1.5	8pqy:A, 8pqz:A, 8pqz:J
7	5nug:A	2920	38	0.1505	0.0048	0.3684	1.6	5nug:B
8	8ptk:f	4502	38	0.1505	0.0031	0.3684	1.8	8ptk:e
9	4bqa:A	132	65	0.1828	0.1288	0.2615	2.1
10	7yni:A	566	31	0.1183	0.0194	0.3548	2.5
11	7sla:A	585	31	0.1183	0.0188	0.3548	2.5	7sl8:A
12	7wmv:A	602	31	0.1183	0.0183	0.3548	2.5
13	7oya:a1	147	46	0.1720	0.1088	0.3478	6.1	7oyb:a1
14	8y9c:B	1609	23	0.0968	0.0056	0.3913	6.1
15	6oq5:A	2346	23	0.0968	0.0038	0.3913	6.3	6oq7:A, 7s0z:B, 7s0z:A
16	8b9z:E	214	18	0.0860	0.0374	0.4444	7.5	8ba0:E, 8esw:V2, 8esz:V2

[Back]