Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
VMEDGYNWRKYGQKLVKGNEFVRSYYRCTHPNCKAKKQLERSAGGQVVDTVYFGEHDHPKP

The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7d11:A 79 61 1.0000 0.7722 1.0000 5.63e-43 6j4e:B
2 6j4f:B 63 59 0.6230 0.6032 0.6441 1.26e-25 6j4f:F
3 6j4g:B 58 58 0.6393 0.6724 0.6724 4.21e-25
4 1wj2:A 71 62 0.5410 0.4648 0.5323 4.41e-19 2lex:A
5 2ayd:A 76 62 0.5410 0.4342 0.5323 8.12e-19
6 8k31:B 79 62 0.4918 0.3797 0.4839 1.43e-15
7 5w3x:D 73 62 0.4590 0.3836 0.4516 9.49e-14 7p8k:B, 5w3x:B
8 7z0r:A 81 63 0.4262 0.3210 0.4127 1.20e-12 7z0r:B, 7z0u:A
9 8iex:A 88 60 0.4426 0.3068 0.4500 2.00e-10
10 6ir8:A 69 59 0.3770 0.3333 0.3898 2.70e-08
11 6vzy:A 464 26 0.1967 0.0259 0.4615 0.29 8e8w:A, 8e8w:B, 6m9r:A, 6m9r:B, 6m9s:A, 6m9s:B, 6m9s:C, 6m9s:D, 6vzy:B
12 6nwz:A 665 27 0.1639 0.0150 0.3704 1.0
13 5gz9:A 280 35 0.1803 0.0393 0.3143 4.0
14 4auc:A 323 22 0.1311 0.0248 0.3636 7.9 1czi:E
15 3vmm:A 471 52 0.1967 0.0255 0.2308 9.7 3wnz:A, 3wo0:A, 3wo1:A
16 3qph:A 335 14 0.1311 0.0239 0.5714 10.0 2f5t:X

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218