BioLiP

>protein
VLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVFSDGTTDITFTCPRSDGRRAMEILKKLQVGNWT
NVLYDDQVGKVSLVGAGMKSHPGVTAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGGEDEA

The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ab4:A	370	153	0.9682	0.4108	0.9935	3.77e-106	3ab4:C, 3ab4:E, 3ab4:G, 3ab4:I, 3ab4:O
2	3aaw:C	392	156	0.9682	0.3878	0.9744	2.24e-103	3aaw:A, 3aaw:B, 3aaw:D, 3ab2:A, 3ab2:B, 3ab2:C, 3ab2:D, 3ab2:E, 3ab2:F, 3ab2:G, 3ab2:H, 3ab2:I, 3ab2:J, 3ab2:K, 3ab2:L, 3ab2:M, 3ab2:N, 3ab2:O, 3ab2:P, 3ab4:B, 3ab4:D, 3ab4:F, 3ab4:H, 3ab4:J, 3ab4:K, 3ab4:L, 3ab4:M, 3ab4:N, 3ab4:P, 2dtj:A, 2dtj:B
3	4go7:X	165	153	0.6497	0.6182	0.6667	9.55e-66	3s1t:A, 3s1t:B
4	2re1:A	148	152	0.4522	0.4797	0.4671	4.17e-41
5	5yei:C	397	152	0.4268	0.1688	0.4408	1.70e-38	5yei:D, 5yei:B, 5yei:A, 5yei:F, 5yei:E, 5yei:H, 5yei:G
6	3l76:A	585	157	0.4013	0.1077	0.4013	1.04e-30	3l76:B
7	3l76:A	585	154	0.3248	0.0872	0.3312	3.71e-24	3l76:B
8	2dt9:A	153	151	0.3694	0.3791	0.3841	1.52e-30	2dt9:B
9	3c1m:C	468	163	0.3057	0.1026	0.2945	5.82e-14	3c1m:A, 3c1m:B, 3c1m:D, 3c1n:A, 3c1n:B, 3c1n:C, 3c1n:D, 3c20:A, 3c20:B, 2hmf:A, 2hmf:B, 2hmf:C, 2hmf:D
10	3tvi:E	439	64	0.1338	0.0478	0.3281	0.002	3tvi:A, 3tvi:B, 3tvi:C, 3tvi:D, 3tvi:G, 3tvi:H, 3tvi:I, 3tvi:L
11	5i35:A	384	42	0.0892	0.0365	0.3333	0.50	7udp:A, 7udq:A, 7udq:B
12	7nkx:Z	156	70	0.1019	0.1026	0.2286	0.68
13	2exu:A	192	70	0.1019	0.0833	0.2286	0.71
14	2cdq:A	470	133	0.2038	0.0681	0.2406	1.2	2cdq:B
15	1ey2:A	419	37	0.0637	0.0239	0.2703	1.2
16	8t0q:A	257	29	0.0701	0.0428	0.3793	2.1	8t0q:B, 8t0v:B
17	6nun:A	516	38	0.0828	0.0252	0.3421	3.9
18	7nrr:AAA	329	34	0.0828	0.0395	0.3824	7.0	7nrr:BBB, 7nsw:AAA, 7nsw:BBB, 7ntd:AAA, 7ntd:BBB, 7nte:A, 7nte:B
19	8q59:A	280	83	0.1146	0.0643	0.2169	8.3	8q57:A, 8q57:B, 8q59:B
20	4ieb:A	472	34	0.0828	0.0275	0.3824	8.6	6bfa:A, 3hx4:A, 3i7b:A, 3i7c:A, 4ifg:A, 4ihp:A, 4jbv:A, 5jms:A, 5jn2:A, 3ku2:A, 4m84:A, 4mx9:A, 4mxa:A, 3n51:A, 3nyv:A, 4ona:A, 3sx9:A, 3sxf:A, 3t3u:A, 3t3v:A, 4tzr:A, 3upx:A, 3upz:A, 3v51:A, 3v5p:A, 3v5t:A, 5w80:A, 5w8r:A, 5w91:A, 5w9e:A, 5w9r:A, 4wg3:A, 4wg4:A, 4wg5:A, 4yga:A, 4yga:C, 4yga:E, 4yga:G, 4yjn:A

[Back]